KEGG   Teredinibacter turnerae: TERTU_3263Help
Entry
TERTU_3263        CDS       T00952                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ttu  Teredinibacter turnerae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ttu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3613796..3614713)
Genome map
AA seq 305 aa AA seqDB search
MAAFFVYERLSRTRNHCSSTTMIIRCGSRDLDLTSPKVMGILNVTPDSFFDGGSNFDNGQ
LFLDKTLHAVEQMLRDGADIVDIGGESTRPGAAKVSVEEECQRVLPVVAAVAERFDTIIS
VDTSTPEVMRQAAQLGAGIINDVRALERDGALAACVETGLPVCLMHMQGTPQTMQDNPDY
NDVVDEVSQYLQGRVAAVETAAGGAACQIILDPGLGFGKSDGHNLALLNQLLALSALGHP
TLVGVSRKSMIGRLLGREPDQRLAGSLGFAMAALVRGASILRVHDVAETRDIVEVFKLTH
LGSQE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctgccttttttgtttatgaacggctttctcgtacacgcaatcactgtagttcgaca
accatgataatccgctgcggttcgcgcgacctcgatcttacttcgcccaaagtcatgggc
attttgaatgtgactcccgattcttttttcgatggtgggtctaacttcgacaacggccag
ctttttctcgataaaaccttacacgcggtcgaacagatgttgcgtgacggcgcagatatt
gtggacattggcggtgaatcgacgcggccgggcgccgcgaaagtgtcggtggaggaagag
tgtcaacgggttctgcccgttgtcgctgcggttgcggagcgctttgacaccattatctcg
gtcgatacgtcaactcccgaggtgatgcggcaagcggcgcagttgggggcaggcattatc
aatgacgtgcgcgccctcgaacgggatggcgcactggcggcatgcgtggagacgggatta
cctgtttgcttgatgcatatgcagggtacgccgcaaacaatgcaggataatccggattac
aacgatgtggtcgacgaagtgtcccaatatctacaggggcgggtggccgcagtggagacg
gcagccgggggcgccgcttgtcagattattctggacccggggttgggttttggaaagtca
gacgggcataatctcgcgcttttaaaccagttgttggcgctatccgcactgggccaccca
acgcttgttggggtgtcgcgaaagtcgatgattggccgccttttggggagggagccggat
cagaggctcgccggcagtcttggctttgcgatggcggcactggtgcgaggcgcatctata
ttacgtgtacacgatgtggcggaaacgcgcgatatcgtggaagttttcaaattgacccat
ttgggatcgcaagaatga

DBGET integrated database retrieval system