KEGG   Teredinibacter turnerae: TERTU_3341Help
Entry
TERTU_3341        CDS       T00952                                 

Gene name
scrP
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ttu  Teredinibacter turnerae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TERTU_3341 (scrP)
Enzymes [BR:ttu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     TERTU_3341 (scrP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3692967..3694478)
Genome map
AA seq 503 aa AA seqDB search
MKNLVQLCTYADRLGCGTFADLTQLLTGKLQGVFGGVHILPFYYPIDGADAGFDPIDHTK
VDERLGDWTDVAALAQSHELMVDVIVNHMSSRSAEFIDYKAHGDASSYASLFLTFDKVFS
RGATESDLVNLYRPRPGLPFSKIRFDDGKERLCWTTFTSDQIDIDVFSDAGQDYLGRILD
RLAAANVKMIRLDAAGYAVKKAGSRCFMTEETFAFIEAFAQKAGARGMEVLVEIHAHFLT
QVAIAKKADWVYDFALPPLVLHTLIAGDSQPLQNWLEISPRNAITVLDTHDGIGIIDIAA
DKQVGAGLLSDEQVDALVEDIHANSEHRSRKATGAAASNVDLYQINCTFFEALGSNENKY
LLARLIQFFAPGIPQVYYVGLFAGENDMALLERTAVGRDINRHYYSEADISAGLETTVVK
HLLALIRFRNLHPAFQTGRFECIGTNAQLLSLAWRASSSHLILEINLQSYSFHLLAESEG
EIQTLDQWRDFDSWVFAHTEIQP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttagtgcaactgtgcacctacgctgatcggctaggttgcggcaccttcgcg
gacttgactcaacttctcactggaaaactgcagggcgtattcggcggagtgcatattttg
ccgttttactaccctatagatggcgcagatgcaggctttgaccctattgatcacaccaaa
gtcgatgaacgactgggcgattggacggacgttgccgcgctggcacaaagtcatgagttg
atggtggacgttattgttaatcatatgtccagccggtcggcagaattcatcgactacaaa
gcccatggtgatgcatccagttacgcttcactgttcctgaccttcgacaaggttttttcg
cgtggtgccaccgaatcagatctggtgaatttgtatcgcccgcgccccgggctgccgttc
agtaaaatcaggtttgacgatggcaaggaacgtttatgctggacaacatttacgtcggac
caaatcgatattgacgtttttagtgatgctgggcaggactatcttgggcgaatactggat
cggctcgcagcggctaacgtaaaaatgatcaggctggacgccgccggttatgcagtaaaa
aaagcgggttcacgctgctttatgaccgaagagactttcgcgtttattgaagcgtttgcg
caaaaggctggcgcacgcggaatggaagtgctggtagaaattcacgcgcattttcttacc
caagtggccatcgccaaaaaagcggattgggtgtacgactttgcccttccgccgctggta
cttcataccttgattgccggtgatagtcagccgctgcaaaactggctggaaatatctcct
cgcaatgcgattactgtgctggatactcacgacggcatcggcattattgatattgcggca
gataagcaagtgggcgcgggtttgttgagcgacgaacaagtcgacgcgctggtcgaagat
attcacgcgaacagtgaacatcgcagtcgcaaggccacgggcgcggctgcatccaatgta
gacctctatcagatcaactgtactttctttgaagcattgggttccaacgaaaataaatac
ctgcttgcgcggctgattcagttttttgcaccgggcattccacaggtgtattacgtgggc
ttgtttgcgggcgaaaacgatatggcgctgttggagcgcactgccgtcggccgcgatatt
aaccggcattattactctgaagcagatatttccgccgggctggaaaccacggtagttaaa
catttactggcgctaatacgctttcgcaatttacacccggcatttcaaacaggtcgtttc
gaatgtataggaaccaatgctcagttgttaagcctcgcgtggcgggcctcgtccagtcac
ctcattttggaaattaatttgcagtcgtacagttttcatttactggccgaaagcgaaggc
gaaatacaaaccctggaccaatggcgggatttcgatagctgggtgtttgcacacacagaa
attcagccgtga

DBGET integrated database retrieval system