KEGG   Teredinibacter turnerae: TERTU_3398Help
Entry
TERTU_3398        CDS       T00952                                 

Definition
xylanase (EC:3.2.1.-)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     TERTU_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3765597..3766742)
Genome map
AA seq 381 aa AA seqDB search
MMRVFAIALLLPLSSLSLTLNAAPANSLQQAYHDAFKVGVAVNPSITRGEDKAVQSIVLS
QFNSITVENALKAAPINPEPGVFEFGPADDYVAFGEKHGMFIVGHTLVWHNQTPGWFFTN
GDGEPNTTKQQLARMESHIKTVAGRYAGRIHAWDVVNEVIDNDGSYRPTTWVNGVGDGDL
MVKSAFKYAEKYAPNTELYYNDFNAWRPAKRDGIVRMVKMLQAEGIRIDGVGIQAHWGLN
FPKTEYIEAAIEAYAALGVKVMITELDVDVLPLTREGQIIGQGMMHPQFQLEEFETYLDP
YKQGLPADVEQALSDRYAALFRLFYKHRDAIDRVTLWGVHDPMSWKNDYPVPGRTNYPLL
WDRSKQPKPALKAVLAVPSEK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgttttcgcaattgcactgctgcttcccctttcctcgctatcactcacactt
aatgctgctccagcaaactctcttcagcaggcctatcacgacgcctttaaagtgggggtg
gcggtaaaccccagtatcacacgcggtgaggataaagcagtccagtcgattgtactgagc
cagttcaatagtattaccgttgaaaacgcactaaaggctgccccgataaaccccgaaccc
ggtgtatttgagttcggtccggccgatgattacgtggcgtttggcgaaaagcacgggatg
tttattgttggtcataccttggtgtggcacaaccagacgccaggctggttttttaccaac
ggtgatggagagcccaataccacgaagcagcagctggcgcgtatggagagccatatcaaa
accgttgcaggtcgttatgccgggcgaattcacgcctgggatgtggtcaatgaagtgatc
gataacgatggttcttaccggccgacaacctgggttaatggggttggcgatggcgacctg
atggtcaagagtgcgttcaaatacgccgaaaaatatgcgccgaatacagaattgtactac
aacgattttaacgcctggcgcccggctaagcgcgacggcattgtgcgtatggtgaagatg
ttacaggccgaggggattcggattgatggcgtagggattcaagcccactgggggctcaat
tttccgaaaacggaatatattgaagcggcgattgaggcctatgccgccttgggcgtgaag
gtgatgatcactgaactagatgtagatgtgttgccgctgacgcgagaggggcaaataatt
ggccaggggatgatgcatccgcagttccaactggaagagttcgagacttatctcgacccg
tataagcaagggttgcctgccgatgttgagcaggcgctgagcgatcggtacgcagcgttg
tttcgcttgttctacaagcatcgtgatgctatcgaccgggtgaccttgtggggcgtgcac
gaccctatgtcctggaaaaacgactatccggttccggggcgtaccaactatccgctgctg
tgggacaggagcaaacagcctaagcctgcgctaaaggctgttttggccgtgccctcggaa
aaataa

DBGET integrated database retrieval system