KEGG   Teredinibacter turnerae: TERTU_4091Help
Entry
TERTU_4091        CDS       T00952                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ttu  Teredinibacter turnerae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TERTU_4091
  Lipid metabolism
   00561 Glycerolipid metabolism
    TERTU_4091
   00600 Sphingolipid metabolism
    TERTU_4091
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TERTU_4091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4531582..4532817)
Genome map
AA seq 411 aa AA seqDB search
MKTIVILALLPFVSLAALADKFEGLALSPPMGWNSWNTFGCDIDEGLIKTIADKMVASGM
RDAGYQYINIDDCWHGERDENGFIQADKTRFPSGIKALADYVHSKGLKLGIYSDAGNKTC
GGRPGSNGHEYQDAIQYARWGIDYLKYDWCNTENLSAPGAYRTMRDALAAAGRPVVLSIC
EWGDNKPWLWGKEMGHLWRTTGDIINCWDCEVDHGSWSSWGILRILDMQDGLRQYAGPDH
WNDPDMMEVGNGMSEHEDRAHFSIWAMLAAPLIAGNDLRSMSKSTQKILTHSEVIAVNQD
ALGVQAFKYKTQNDVEIWFKPLQDKQWAMMILNRGDKKAGVSFDWRNENVVDPDFPGNGQ
FYTAGFANSRYKIFDLWANKSAGTTKSSLRVSVEPHAVKLYRLEKITSEIH
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactatcgtaattttggcgttgttgccgtttgtttcgctggcggctctggcagat
aaatttgaagggctcgctctgtcgccgccaatgggttggaacagctggaacaccttcggc
tgcgacattgatgagggcctgataaagaccattgccgataaaatggtggcctcgggtatg
cgcgatgcgggttatcagtacataaatatcgatgattgctggcatggcgagcgcgatgaa
aatggctttattcaggcagataaaacccgttttccgtccggtataaaagcgctcgcggat
tatgttcacagtaaaggtttgaaactgggtatttattccgatgctggcaataaaacctgt
ggcgggcgacctgggtcgaacggccatgaatatcaggacgcgatccagtatgcccgctgg
ggtattgattatctgaaatacgattggtgcaacactgagaaccttagcgcccccggcgcc
tatcgcacaatgcgcgatgcacttgcagccgccggccgaccagtggtgctcagtatctgt
gagtggggtgacaataaaccctggttgtggggcaaagagatgggccatctttggcgcacc
acaggcgatattattaattgctgggattgtgaagtggaccatgggagctggtcgtcctgg
ggtattttgcgcattttggatatgcaggacgggttacgacagtacgcggggccagaccac
tggaatgacccggacatgatggaagtgggcaacgggatgagcgaacatgaagatcgcgcg
catttttctatatgggcgatgctggccgcgccattgattgccggcaacgacttaagaagc
atgtcaaaatccacccaaaaaatactgacgcattcagaagttatcgcggtaaaccaggat
gcgcttggcgtgcaggcttttaaatataaaacgcagaacgatgtggagatttggtttaag
cccttgcaggataaacaatgggcaatgatgattcttaatcggggcgataaaaaggcaggc
gtatcgtttgactggcgcaacgaaaatgttgttgacccggactttccgggcaacggacaa
ttttataccgcgggttttgcaaattcccggtacaaaattttcgatctgtgggcgaacaaa
tctgccggcacgacaaaatcttcgctgcgtgtctcagtggaacctcacgcagtaaaactg
tatcggttggaaaaaatcaccagtgaaattcattaa

DBGET integrated database retrieval system