KEGG   Teredinibacter turnerae: TERTU_4402Help
Entry
TERTU_4402        CDS       T00952                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TERTU_4402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4874061..4875230
Genome map
AA seq 389 aa AA seqDB search
MSIKTYCALIFGALILAACGGESYTEVEITEQERSYRQLLGVPDHFSLPHIPEFNPPTIE
KIDLGHFLFYDKQLSANQTQSCASCHVQELAFTDGQARPFGSTGDRLTRNSQGLGNAAYH
ATFTWSNDGFLNLEDQLAVPIRSDNPVELGVTEAKVDEVLARFDADPVYRKKFAAAYPEA
ESGATVTKIIYALASFCRTLISGSSPYDNYLLGDDSALTDQQKWGLQLFNGEKFECFHCH
SGLNFSVSYRDNNSDPATQTFPFFNNGLYNVDGTGSYPQEDQGLYDLTQKLQHRGLFRPQ
CLRNVAVTAPYMHDGSIDTLREVLEHYARGGRKVETGIYQGDGRLSPLKSGLVRGFAATD
DELDAVEAFLESLTDDAFISDPAFANPFE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattaaaacctattgtgcgttgatctttggtgcgctgattctggctgcctgtggt
ggcgaatcttataccgaagtggagataaccgaacaagagcgcagttatcgccaacttctg
ggtgttccagatcacttctcattacctcacattccagaattcaatccgccgactatagag
aaaattgatctcgggcattttctcttctatgacaaacaactgtccgccaaccaaacccag
agctgcgccagttgtcatgtgcaagaattggcttttaccgatggccaggcgcgcccattc
ggttctacaggcgaccgactcacgcgcaatagtcaaggtctgggtaatgccgcttatcac
gcgacattcacctggtcgaacgacggctttcttaatttagaggatcaactggcagtgcct
atccgatccgataacccggtagagctcggggtaaccgaggcgaaagtcgacgaggttctc
gcgcgtttcgatgcagaccctgtgtatcgaaaaaaattcgctgccgcgtatccagaagca
gagagcggcgcgacggtcacaaaaataatctatgcacttgccagcttttgccgcaccctc
atctcgggcagcagcccttacgataattatttactcggtgacgacagtgcactcaccgat
caacagaaatgggggctgcaattattcaatggcgaaaaatttgaatgcttccattgccac
tcgggtttgaatttttcagtttcctaccgagataacaacagcgacccggcaacccagacg
ttcccgtttttcaataatggcctgtacaacgtggatggcaccggtagctatccgcaggaa
gaccaagggctttatgatctcacccaaaaactgcagcatcgcggcctgttccggccgcag
tgcttgcgcaacgtggcagtcacggccccctatatgcacgatggcagcatcgacacatta
cgcgaagtactcgagcactatgcacgcggcggacgtaaagtagaaacgggtatttaccag
ggcgatggtcgtttaagccctcttaaatccgggctcgtacgtggcttcgctgcaaccgac
gatgagttggatgcagtcgaagcgttcttggaatccctcaccgacgacgcatttatttct
gaccccgcatttgcaaacccgttcgagtaa

DBGET integrated database retrieval system