KEGG   Teredinibacter turnerae: TERTU_4650Help
Entry
TERTU_4650        CDS       T00952                                 

Definition
(GenBank) ggdef domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ttu  Teredinibacter turnerae
Brite
Enzymes [BR:ttu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     TERTU_4650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5099406..5101148
Genome map
AA seq 580 aa AA seqDB search
MVETAGGSYKEKYLQALADQERQEKQFQFQLEMLRKALNHLAAAAQGLDKTLDAELLLLK
DRMRGASGHQVVDQFERVQKAVIQFERLRDSEHSTAAGKMRAMLEGLLVLQLPDDLARKV
QSAARAMEQSLHNYRSYPLVLGEVTLLQQAALEAAMNPKAGFWQRLRGGRTVQSRAESVE
TPELQRKSVSAELTDENLQLAPAGGADLNTVPAPLKPANHLLAEDDFDKVAERICRTLRN
LVESIEPNDIVRHKVDIVRARIQRGLDWFALAVTLDDLRDILMQRYLDVDREFSQYLLQV
NAELRSISDVLGIALEQENQVQQAAQTLSKKVGDEVEKIHASLAASTEIQSLKQAVTNHL
DVIHKALAEFHSGHLRAENANLSDQLQALLAKVESIESESSKTKELLEEERYRATHDSLT
GLPNREAYNERVYQEYRRFTRYSRPLGIAVCDIDHFKKINDNFGHQTGDRVLKLIARLIS
TRLRKVDFVARYGGEEFVILLPETSASQSRSVLDKIRAAVAKAAFRFGDDPVKITLSFGI
SAFRSDDTIETAFQRADKALYQAKADGRNRCVVDTDDAEA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaacagcgggtggtagttacaaagagaagtacctccaagcgctggcagaccag
gaacggcaagaaaagcaatttcagtttcaattggaaatgttgcgcaaggcgctaaatcat
ctggcagcggctgcacagggtttagacaaaacccttgatgccgagctactgctgctgaaa
gatcgcatgcgcggcgccagtgggcatcaggttgtcgatcagtttgaacgggtgcaaaaa
gcggtaatccagttcgagcgcctgcgcgacagcgaacacagtaccgccgccggtaaaatg
cgcgcaatgctcgagggcctgttggtactgcaactgcccgatgacctcgcacgcaaggtg
caatcggcggcaagggcgatggagcaatcactccacaattaccgcagttaccctcttgtt
ctcggcgaagtgacgctgctccagcaagcggcgctggaagcggcgatgaaccccaaggcg
ggtttctggcagcgcctcagaggcgggcgtaccgtgcagtcccgcgctgaatcggtggaa
accccggagctgcaacgcaagtccgtcagcgctgaactcaccgatgaaaacttacagctt
gcgcccgccggcggcgctgatctgaacactgtgcccgcgcccttgaaaccagccaatcat
ctgctggctgaggacgatttcgacaaggtcgctgagcgcatttgtcgcaccctgcgcaac
ctggtggagtctatcgagccaaacgatatcgtgcgccacaaggtggatatcgtccgcgcc
cggatacagcgtgggctcgattggtttgcccttgcggtcactctggacgacctgcgcgat
attctgatgcagcgctacctggacgtcgatcgggagttcagccaatacctgctgcaagtg
aacgccgagctgcgcagtatttctgatgtgctgggtattgcgttggagcaggagaaccaa
gtccagcaggcagcgcaaaccctgagtaaaaaagtcggcgacgaagtggagaaaatccac
gcctcgctagccgccagtaccgaaattcagagtctgaagcaagcggtgactaaccatctt
gacgttatccacaaagcgctggccgaattccatagtggacacctgcgggcggaaaacgcc
aacctgagcgaccaattacaggcactgctggcgaaggtggagtcgatagaaagcgaatcc
agtaaaaccaaggaactgctcgaagaagaacgctaccgggcaacccacgacagcctcact
ggcctgcctaaccgggaggcgtacaacgaacgggtgtaccaggagtatcgccgcttcacc
cgctacagccggccgctcggcattgccgtgtgcgatatcgaccacttcaaaaagattaac
gacaatttcggccaccagactggcgacagggtgttaaagctgatcgctcgcttgatttcc
acgcgcctgcgcaaagtggacttcgtcgcgcgctacggtggcgaggagttcgtgatcttg
ctacctgaaaccagtgcgagccaaagtcgctcggtgctcgacaaaattcgcgctgcagtg
gccaaggccgcctttcgcttcggcgacgacccggtcaaaatcaccctatcgttcggtatc
tcggcattccgcagcgacgatacgattgaaactgcgtttcaacgggccgacaaagcgctc
taccaggccaaggccgatggccgcaaccgctgcgttgtggataccgatgacgccgaggca
taa

DBGET integrated database retrieval system