KEGG   Tupaia chinensis (Chinese tree shrew): 102468703Help
Entry
102468703         CDS       T02978                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102468703 (DBH)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102468703 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 603 aa AA seqDB search
MREAASIYCTVVACYLVILLAVLQGLATPESPFPYHIPLDPKGTLELSWNVSYAQEDIHF
QLRVHGLRAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQKGQIHLDPQQDYQLL
QAQRTPEGLTLLFKRPFGTCDPKDYLIEDDTVHLVYGILEEPFRSLEAINISGLQTGLQR
VQLLKPDLPIPAVPSDTRTMEIRAPDVQVPGQETTYWCYVTELPAGFSKHHIVMYEPIVT
EGNEALVHHMEVFQCAAAFESIPHFSGPCDSKMKPDRLNFCRHVLAAWALGAKAFYYPEE
AGLAFGGPGSSRYLRLEVHYHNPLKLEGRRDSSGIRLHYTASLRRFDAGIMELGLVYTPV
MAIPPRESAFVLTGYCTDKCTQLALPPSGVHIFASQLHTHLTGRKVVTVLARDGREREVV
NRDNHYSPHFQEIRMLRKLVSVHPGDVLITSCTYNTEDRKLATVGGFGILEEMCVNYVHY
YPQTQLELCKSAVDDGFLQKYFHLVNRFNSEDVCTCPQASVPQQFASVPWNSFTRDTLKA
LYGFAPISMHCNKSSAVRFQGEWNLQPLPEITATLEEPAPQCPPRQSQSPAGPAVVSFGR
GRS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggccgcgtccatctactgcacagtggtggcctgctacctggtcatcctgctg
gccgtgctgcagggcttggcgacccctgagagccccttcccctaccacatcccgctggac
cccaaggggacgctggagctctcgtggaacgtcagctacgcccaggaagacatccacttc
cagctccgcgtgcatgggctcagggctggggtcctgttcgggatgtcggaccgcggggag
ctggagaatgccgacctcgttgtgctctggaccgacggcgacacggcctacttcgcggac
gcctggagtgaccagaaggggcagatccacctggatccccagcaggactaccagctgctg
caggcccagaggaccccagagggcctgaccttgctcttcaagaggccctttggcacctgt
gaccccaaggattacctcatcgaggatgacaccgtccacctggtttatgggatcctggag
gagccgttccggtcgctggaggccatcaacatctcgggactgcagacagggctgcagagg
gtgcagctgctgaagcccgacctccccatcccggcagtgccctccgacacacgcaccatg
gagatccgcgcccccgatgtccaggtgccgggccaggagaccacctactggtgctacgtc
accgagctcccggccggcttctccaagcaccacattgtcatgtacgagcccatcgtcacg
gagggcaacgaggccctcgtgcaccacatggaggtcttccagtgcgcagccgcgttcgag
agcatcccccacttcagcgggccctgcgactccaagatgaagcccgaccgcctcaacttc
tgccgccatgtgctggcggcctgggccctgggcgccaaggcattctactacccagaggaa
gccggcctggcttttgggggccctgggtcctccagatacctccgcctggaagttcactac
cacaacccgctgaagctggaaggccggcgcgactcctcaggcatccgcctgcactacacg
gcctcactgcgtcgcttcgatgcgggcatcatggagctggggctggtgtacacgcccgtg
atggccatccccccacgggagagcgccttcgtcctcaccggctactgcacagacaagtgc
acccagctggcactgccgccctccggggtccacatcttcgcctctcagctccacacgcac
ttgacggggaggaaggtggtcaccgtgctggcccgcgatggccgcgagagggaggtcgtg
aacagggacaaccactacagcccccacttccaggagatccgtatgttgaggaagctcgtg
tccgtccacccgggggatgtgctcatcacttcctgcacctacaatacggaggacaggaag
ctggccactgtgggcggctttgggatcctggaggagatgtgtgtcaactacgtgcactac
tacccccagacgcagctggagctctgcaagagtgctgtggacgatggcttcctgcagaag
tacttccacctggtgaacaggttcaacagcgaggacgtctgcacctgcccgcaggcctcc
gtgcctcagcagttcgcctccgtgccctggaactccttcacccgcgacacgctcaaggcc
ctgtacggcttcgcgcccatctccatgcactgcaacaagtcctccgccgtccgcttccag
ggcgagtggaacctgcagcccctgcctgagatcactgccacactagaagagcctgcccca
caatgcccccctcgccagagtcagagccccgctggccccgccgtggtcagctttggcagg
ggcagaagctga

DBGET integrated database retrieval system