KEGG   Tupaia chinensis (Chinese tree shrew): 102471290Help
Entry
102471290         CDS       T02978                                 

Definition
neuroendocrine convertase 1-like
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102471290
Peptidases [BR:tup01002]
 Serine Peptidases
  Family S8: subtilisin family
   102471290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 751 aa AA seqDB search
MERKAWTLQCTAFVLFCAWCASNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAPHITKRLSDDDRVIWAEQQYQKERSKRSALRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYDN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNRKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWSSVFFXCVVKDNDFEPRALKAN
GEVIIEIPTRACEGQENAITSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERD
TSPNGFKNWDFMSVHTWGENPIGTWTLQITDMSGRMQNEGRIVNWKLILHGTSSQPEHMK
QPRVYTSYNTVQNDRRGVEKMADSGEEQPTQENPKEDSLVSKSPSIGSVGSRRDELEERA
PSEAMLRLLQSAFSKNSPPKLSPKKSASAKLHIPYENFYEALQKLNQPAQLKNSEDSLYN
DYVDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaagcctggactctgcagtgtacagctttcgtcctcttttgcgcttggtgt
gcgtcgaacagtgtaaaagctaagaggcagtttgtcaatgaatgggctgcggagatcccc
gggggcccggaagcagcctcggctatcgcggaggagctgggctatgaccttttgggtcag
attggatctcttgaaaatcactacttgttcaaacataaaaaccatccccgaaggtctcga
aggagtgctcctcatatcactaagagattatctgatgatgatcgtgtgatatgggctgaa
caacaatatcaaaaagagagaagtaaacgttcggctctaagagactcagcactaaatctc
ttcaatgatccaatgtggaatcagcagtggtacttgcaagacacaagaatgaccgcagcc
ctgcccaagctggatcttcatgtgatacctgtttggcaaaaaggcattacaggcaaagga
gttgtcatcacagtcctggatgatggcttggagtggaatcacacggacatttatgacaat
tatgatccggaggctagctatgattttaacgataatgaccatgatccgtttccccgatat
gatcccacaaatgaaaacaaacatggaaccagatgtgcaggagaaattgctatgcaagca
aataatcgcaagtgtggagttggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgacggatgctattgaggccagctccattggattcaatcctggacat
gtggatatttacagtgcgagctggggtcctaatgatgatgggaaaactgtggaggggccc
ggcagactagcccagaaagcttttgaatatggcgtcaaacaggggaggcaagggaaaggc
tccatcttcgtctgggcttccgggaacgggggccgtcagggagataactgtgactgcgat
ggctacacggacagcatctacaccatctccatcagcagcgcctcccagcaaggcctatcc
ccctggtatgctgagaagtgctcctccaccctggccacctcttacagcagcggggattac
accgaccagcgaattaccagtgctgacctgcacaatgactgcacagagacccacacgggc
acctcggcctcggcacccctggcggctggcatctttgctctggccctggaagcaaaccca
aatcttacctggcgagatatgcaacatttggtcgtgtggacctctgaatatgatccactg
gccaataaccctgggtggaaaaagaatggagcaggcttgatggtgaacagtcgatttgga
tttggtttactcaatgccaaagctctggtggacttagctgaccccaggacctggagcagt
gtgtttttttagtgtgttgtaaaggacaatgactttgagcccagagccctgaaagcaaat
ggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaatgctatcaca
tccctggagcatgtacagtttgaagcaacaattgaatattcccgtagaggagaccttcat
gtcacactcacttctgctgcaggaaccagcactgtcctgctggctgaaagagagcgggat
acatcccctaatggctttaagaattgggacttcatgtctgttcacacatggggagagaac
cctataggcacctggactttgcaaattacagacatgtctggaagaatgcaaaacgaagga
agaattgtgaactggaagctaattctgcatgggacatcttctcagcctgagcacatgaaa
caacctcgcgtgtatacatcctacaacactgttcagaatgacagaagaggggtggagaag
atggctgattccggggaggagcagcccacacaagagaaccctaaagaggactccctggtg
tccaaaagccccagcatcgggagtgtggggagcagaagggatgagctggaagagagggcc
ccttccgaggccatgctgcgactcctacaaagtgctttcagcaaaaattccccaccaaag
ctatcaccaaagaagtctgcaagtgcaaagctccatatcccttatgaaaacttctacgaa
gccctgcaaaagttgaaccaacctgctcagcttaaaaactctgaggacagtctgtataac
gactacgttgatgttttctacaacacaaaaccttacaagcacagagatgaccggctgctg
caggccctggtggacatcctgaatgaggaaaattga

DBGET integrated database retrieval system