KEGG   Tupaia chinensis (Chinese tree shrew): 102471803Help
Entry
102471803         CDS       T02978                                 

Gene name
ENTPD2
Definition
ectonucleoside triphosphate diphosphohydrolase 2
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    102471803 (ENTPD2)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     102471803 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 320 aa AA seqDB search
MAXKVLSPLPPLLLAAAGFAGLLLLCVTTRNVRDPPAFEYGIVFGAGSSHTSMFIYKWPA
DKEXSMGVVGQPSSCDVQGGGLSSYPEGPSGAGQSLAECLEQALRDVPRGSRMGTPLYLG
ATVGMCPMDLSSPEASASVSARVFAAVMRMLAQYPFDFQGTRTLSGQDEGVFGWVTANYL
LENFIKCDWVGRWFRPKKGTLGAMDLGGASTXIEMASAAEAQANEVQLRLXGQHYRVYTH
SFLCYGXDQVLQRLLASAHKTHGFHPCWPRGYSAPVLPLDVFQSSCTATQRPLLLLFAAL
LLVALVLLLRQVPSKSRSTI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcctgaaaggtgctttccccactgcccccgctgctgctggctgcggcgggcttcgct
ggcctgctgctgctgtgcgtcaccacccgcaacgtccgcgatccgccagccttcgagtat
ggcattgtcttcggagctggctcctcgcacacgtccatgttcatttataagtggcctgcg
gacaaagagnnctccatgggcgtcgtgggacagcccagctcctgcgatgttcaaggtggg
ggcctctccagctacccagagggcccttctggggctggccagagtcttgctgagtgcctg
gagcaggcacttcgggacgtgcccagggggagccgcatgggcacgcccctctacctggga
gccacggtgggcatgtgccccatggacctgtccagtccagaagcctctgccagcgtgtct
gccagagtgtttgccgccgtgatgcggatgctggcccagtacccctttgacttccagggc
acacgcaccctctccggccaggatgagggggtgtttggctgggtgacagccaactacctg
ctggagaatttcatcaagtgcgactgggtgggccgctggtttcggccaaagaaggggaca
ctgggggccatggacctgggaggggcctccacanncattgagatggccagtgcggctgag
gctcaggccaacgaagtccagctgaggctctaaggccagcactaccgagtctacacccac
agcttcctctgctatggctgagaccaggtccttcagaggctgctagccagtgcccacaag
acccacggcttccacccttgctggccaaggggctactccgctccagtgctgcccctggat
gtgttccagtcgtcatgcaccgcgacccagcggcctctgctcctgctcttcgccgctctg
ctgctggtggcgctggtcctgctgctgcgccaggtcccctccaagtcgcggagcaccatc
tag

DBGET integrated database retrieval system