KEGG   Tupaia chinensis (Chinese tree shrew): 102472146Help
Entry
102472146         CDS       T02978                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102472146 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102472146 (GYS2)
   04152 AMPK signaling pathway
    102472146 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102472146 (GYS2)
   04922 Glucagon signaling pathway
    102472146 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102472146 (GYS2)
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102472146 (GYS2)
Glycosyltransferases [BR:tup01003]
 Polysaccharide
  Storage polysaccharide
   102472146 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEVEDLPIEELLLFEVAWEVTNKVGGIYTVIQTKAKTTSDEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDAVRKAVDTMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEAWXXXXXXXXXNDMLIFGSLTAWFLKEVTDHADGKHVVAQFHEW
QAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHRY
CMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVITPNGLNVKKFSAVHEFQNLHAMYKA
RIQDFVRGHFYGHLDFDLDKTLFLFIAGRYEFSNKGADIFLESLTVLCFLIPHQMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPELNNIL
DRDDLTIIKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHMESTSPPMTEGFKYPRPSSVPPSPSWSQASSPQSSDVE
DENEDERYDEEEEAERDRLNIKSPFALSHAPPGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatctttatcagtgacgtccctcagtgggcttccccagtgggaagta
gaagatcttcccatagaagagttgctgctttttgaagttgcttgggaggtgaccaacaaa
gtcggaggcatctatactgtgattcagacaaaggccaaaacaacctcagatgaatgggga
gacaattattttctgataggaccctattttgagcacaatatgaagacgcaggtggaacag
tgtgagcctgtgaatgatgctgtccgaaaagcagtggacacgatgaataagcacggctgc
caggtgcattttggaaggtggctgatagaagggagtccttacgtggtgctctttgacata
ggctattcagcttggaatctggacaggtggaagggagacctctgggaggcctggnnnnnn
nnnnnnnnnnnnnnnnnnnncaacgacatgctgatatttggatctttaactgcctggttc
ttaaaagaggtgacagatcatgcagatggtaaacatgttgttgctcagttccacgaatgg
caggccggaactggactgatcctttcccgagcccggaaacttccaattgccacagtattt
accacccatgccacactccttgggcggtatctctgtgcagcaaatattgatttctacaac
catcttgataagtttaacatagacaaagaagctggagaaaggcagatttaccaccggtac
tgtatggagcgtgcctcggtgcattgtgctcatgtcttcaccacagtttctgaaatcaca
gccattgaggcggaacacatgctgaagagaaagcctgacgtaattactccaaatggcttg
aatgtgaagaaattttcagcagtgcatgaatttcaaaacctccacgccatgtacaaggcc
aggattcaagattttgttaggggtcatttctatggtcatctagactttgatcttgacaag
actttgttccttttcatcgctgggaggtatgagttttcgaacaaaggagctgacatcttc
cttgaatcgttgactgtgttgtgttttctaatccctcatcagatgcataaaagtgatgtc
acagtggtggtgtttttcattatgcctgccaagacaaacaatttcaatgtggaaacactg
aaaggacaggcagtgcgaaaacagctatgggacactgcacattctgtgaaagaaaagttt
ggaaagaaactctatgatgcattattaagaggagaaattcctgagttgaacaatattttg
gatcgagatgatctcacaattattaaaagggccatcttttcaacacagcgacagtctttg
cctccagtgaccactcacaacatgattgacgactccactgatcccatcctcagcaccatc
cgccggattgggcttttcaacaaccgcgcagacagagtaaaggtgattctgcacccagaa
tttctatcctctaccagtcccttattacccatggattatgaagagtttgttcgaggctgt
catcttggagtatttccgtcatactatgagccctggggttatactccagctgaatgcaca
gtgatggggatccccagtgtgaccacaaacctgtctggcttcggttgtttcatgcaggag
catgtggctgatcctactgcttatggcatttacattgttgacagacggttccgctctcca
gatgactcttgcaatcagctgactcagtttctctacggattttgtaaacagtcaaggcgc
caaagaattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatactaccagcatgccaggcacctgacattaagcagagcttttccagataaa
ttccacatggaatccacatcaccaccaatgacagaaggatttaaatatcccaggccttcc
tccgtaccaccttctccttcatggtctcaggcctccagtcctcaaagcagtgatgtggaa
gatgaaaatgaggacgagcgatatgatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcaccatttgctctgagtcatgcccctcctgggaagaagaaactgcatggtgaa
tacaagaactga

DBGET integrated database retrieval system