KEGG   Tupaia chinensis (Chinese tree shrew): 102472146Help
Entry
102472146         CDS       T02978                                 

Gene name
GYS2
Definition
glycogen synthase 2 (liver)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102472146 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102472146 (GYS2)
   04152 AMPK signaling pathway
    102472146 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102472146 (GYS2)
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102472146 (GYS2)
Glycosyltransferases [BR:tup01003]
 Polysaccharide
  Storage polysaccharide
   102472146 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEVEDLPIEELLLFEVAWEVTNKVGGIYTVIQTKAKTTSDEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDAVRKAVDTMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEAWXXXXXXXXXNDMLIFGSLTAWFLKEVTDHADGKHVVAQFHEW
QAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHRY
CMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVITPNGLNVKKFSAVHEFQNLHAMYKA
RIQDFVRGHFYGHLDFDLDKTLFLFIAGRYEFSNKGADIFLESLTVLCFLIPHQMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPELNNIL
DRDDLTIIKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHMESTSPPMTEGFKYPRPSSVPPSPSWSQASSPQSSDVE
DENEDERYDEEEEAERDRLNIKSPFALSHAPPGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatctttatcagtgacgtccctcagtgggcttccccagtgggaagta
gaagatcttcccatagaagagttgctgctttttgaagttgcttgggaggtgaccaacaaa
gtcggaggcatctatactgtgattcagacaaaggccaaaacaacctcagatgaatgggga
gacaattattttctgataggaccctattttgagcacaatatgaagacgcaggtggaacag
tgtgagcctgtgaatgatgctgtccgaaaagcagtggacacgatgaataagcacggctgc
caggtgcattttggaaggtggctgatagaagggagtccttacgtggtgctctttgacata
ggctattcagcttggaatctggacaggtggaagggagacctctgggaggcctggnnnnnn
nnnnnnnnnnnnnnnnnnnncaacgacatgctgatatttggatctttaactgcctggttc
ttaaaagaggtgacagatcatgcagatggtaaacatgttgttgctcagttccacgaatgg
caggccggaactggactgatcctttcccgagcccggaaacttccaattgccacagtattt
accacccatgccacactccttgggcggtatctctgtgcagcaaatattgatttctacaac
catcttgataagtttaacatagacaaagaagctggagaaaggcagatttaccaccggtac
tgtatggagcgtgcctcggtgcattgtgctcatgtcttcaccacagtttctgaaatcaca
gccattgaggcggaacacatgctgaagagaaagcctgacgtaattactccaaatggcttg
aatgtgaagaaattttcagcagtgcatgaatttcaaaacctccacgccatgtacaaggcc
aggattcaagattttgttaggggtcatttctatggtcatctagactttgatcttgacaag
actttgttccttttcatcgctgggaggtatgagttttcgaacaaaggagctgacatcttc
cttgaatcgttgactgtgttgtgttttctaatccctcatcagatgcataaaagtgatgtc
acagtggtggtgtttttcattatgcctgccaagacaaacaatttcaatgtggaaacactg
aaaggacaggcagtgcgaaaacagctatgggacactgcacattctgtgaaagaaaagttt
ggaaagaaactctatgatgcattattaagaggagaaattcctgagttgaacaatattttg
gatcgagatgatctcacaattattaaaagggccatcttttcaacacagcgacagtctttg
cctccagtgaccactcacaacatgattgacgactccactgatcccatcctcagcaccatc
cgccggattgggcttttcaacaaccgcgcagacagagtaaaggtgattctgcacccagaa
tttctatcctctaccagtcccttattacccatggattatgaagagtttgttcgaggctgt
catcttggagtatttccgtcatactatgagccctggggttatactccagctgaatgcaca
gtgatggggatccccagtgtgaccacaaacctgtctggcttcggttgtttcatgcaggag
catgtggctgatcctactgcttatggcatttacattgttgacagacggttccgctctcca
gatgactcttgcaatcagctgactcagtttctctacggattttgtaaacagtcaaggcgc
caaagaattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatactaccagcatgccaggcacctgacattaagcagagcttttccagataaa
ttccacatggaatccacatcaccaccaatgacagaaggatttaaatatcccaggccttcc
tccgtaccaccttctccttcatggtctcaggcctccagtcctcaaagcagtgatgtggaa
gatgaaaatgaggacgagcgatatgatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcaccatttgctctgagtcatgcccctcctgggaagaagaaactgcatggtgaa
tacaagaactga

DBGET integrated database retrieval system