KEGG   Tupaia chinensis (Chinese tree shrew): 102472309Help
Entry
102472309         CDS       T02978                                 

Gene name
NEU2
Definition
sialidase 2 (cytosolic sialidase)
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102472309 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102472309 (NEU2)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102472309 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 376 aa AA seqDB search
MAPVPVLQKERVFQSGFQTYRIPALLYLPQQKILLAFAEERVDLVDEHAELIVLRRGVYD
VNTHRVQWQAQEVVTQARLEGHRSMNPCPLYDEQTETLSLFFIVVLGQVSEHHQLQTRVN
VTRLCQVTSSDHGRTWSPARDLTDSAIGPAHKQWATFAVGPGHCLQLHDKPRSLVVPAYA
YRNLHPHQRPSPFAFCFLSHDHGDTWHSGNFVGQDSLECQVAEVGAGAQRAVYLNARSFH
RARVQAQSTNDGLDFNETQLVKKLVEPPYGCHGSVVSFPSPRAGPGASERWLLYTHPSDL
HERADLGVYLNAQPPDPAAWSAPALLAEGGCAYSDLQSMGPGPDGSPLFGCLYESDNYKE
IIFVLFTLKQAFPGEF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctgtcccagtcctgcagaaggagagagtgttccagtcggggttccagacctat
aggatccccgccctgctctacttgcctcagcagaagatcctgctggccttcgcagaagag
cgtgtggacctggtggatgagcacgcggagctgattgtcctgcgcagaggagtgtacgat
gtgaacacccaccgggtgcagtggcaagctcaggaggtggtgacccaagcccggctggag
ggccaccggtccatgaacccatgccccttgtacgacgagcagacggagaccctttccctc
ttcttcattgtcgtgctggggcaggtctctgagcaccaccagctccagaccagggtcaac
gtgacacggctgtgccaagtcaccagctctgaccacgggaggacctggagccctgccaga
gacctcacggactctgccatcggcccagcccacaagcagtgggccacctttgcggtgggc
ccagggcattgcctgcagctgcacgacaagccccgcagcctggtggtgcctgcctatgcc
taccggaacctccacccccaccagcggccgtcccccttcgccttctgcttcctcagccac
gaccacggggacacatggcacagcgggaacttcgtgggccaggacagcctggagtgccaa
gtggctgaagtcggggctggggcgcagagggcggtgtacctcaatgctagaagcttccac
agagccagggtccaggcccagagcaccaatgatggactggattttaatgagacccagctg
gtgaagaagctggtggaacctccctatggctgccacggcagcgtcgtcagcttccccagc
ccccgcgcagggccgggcgcctcagaaagatggctgctctacacccacccctctgacctg
catgagagggccgacctgggtgtgtacctcaacgcgcagcccccggacccggcagcctgg
tcggcacccgctctgctggccgagggcggctgcgcctactcagacctccagagcatgggc
cctggccccgacgggtcacccctgttcgggtgtctctatgaatcggataattataaggag
atcatcttcgtcctcttcaccctgaaacaagccttcccaggtgaattttag

DBGET integrated database retrieval system