KEGG   Tupaia chinensis (Chinese tree shrew): 102476156Help
Entry
102476156         CDS       T02978                                 

Gene name
KAT2B
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:tup00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102476156 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102476156 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102476156 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    102476156 (KAT2B)
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102476156 (KAT2B)
Transcription machinery [BR:tup03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102476156 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 680 aa AA seqDB search
MQKVAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEE
MNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFE
KPSIEQGVNNFVQYKFSHLPSKERQTIVELAEMFLNRINYWHLEAPSQRRLRSPNDDISG
YKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLE
KRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVISPPPVAGTISYN
SNSSSLEQPNGGSTSPVCKASSGLEASPGEKRKMNDSHVVEEAKKPRVMGDIPMELINEV
MSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLSQKPNKQILMWLVG
LQNVFSHQLPRMPKEYITRLVFDPKHRTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVT
SNEQVKGYGTHLMNHLKEYHIKHDIRNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYI
KDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQ
IPIESIPGIRETGWKSSGKERSKEPKDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEA
PGYYEVIRFPMDLKTMSERL
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagtggccgaggagtcctgtaaatgtaatggctggaaaaaccccaacccttct
cccactcccccgagagcggacctgcagcaaatcattgtcagtctcacggaatcctgtcgg
agctgcagccatgccctggctgctcatgtttctcacctggaaaatgtgtccgaggaagaa
atgaaccgacttctggggatcgtgctggatgtggagtatctttttacctgtgtccacaag
gaagaagatgcagataccaaacaagtttatttctacctattcaagctcttgagaaagtct
attttacaaagaggaaaacctgtggttgaaggttctttggagaagaaacccccttttgaa
aagccaagtattgagcagggcgtgaataactttgtacagtacaaattcagtcacctgcca
tcgaaagaaaggcaaaccatagtcgagttggcggaaatgttcctgaaccgtatcaattat
tggcacctggaggccccatcgcaacgaaggctgcgatctcccaacgacgacatttctggt
tacaaagagaactacacaaggtggctgtgttactgcaacgtgccacagttctgtgacagt
ctacctcggtacgaaaccacccaggtatttggaagaacactgcttcgctcggtcttcact
gtgatgaggcgacaactgctggaacaagcaagacaggagaaagacaaactgcccctggaa
aaacggactctaatcctcacccactttccaaagtttctgtccatgttagaagaagaagtt
tacagtcaaaactctcccatctgggatcaggattttctgtcagcctcttccagaaccagc
cagctaggaatccaaacagttatcagcccgcctcctgtggctgggacgatttcatacaat
tcaaactcgtcttccttggaacagccaaatggagggagtacaagtcctgtttgcaaagcc
tcttctgggcttgaggcaagcccaggagaaaaaaggaaaatgaatgactcccatgttgtg
gaggaggccaagaaaccccgagttatgggggatattccgatggaattaatcaacgaggtt
atgtctaccatcacagaccctgcagccatgctgggaccagagaccaattttctgtcagca
cattcggccagggacgaggcggccaggctggaggagcgcaggggtgtcattgagtttcac
gtggtcggcaattctctgagccagaaacccaacaagcagatcctgatgtggctggtcggc
ctccagaacgtattctcccaccagctgccccggatgcccaaggagtacattacccggctc
gtttttgatccgaaacacagaacccttgctttaattaaagatggccgtgttattggtggt
atctgtttccgcatgttcccatcccaaggattcacagagattgttttctgtgctgttacc
tcaaatgaacaagtcaagggctatgggacgcacctgatgaatcatttgaaagaatatcac
atcaaacacgacatccggaacttcctcacgtacgcggatgaatatgcaatcgggtacttc
aagaaacagggtttctccaaagaaattaaaatacctaaaaccaaatatgtcggctacatc
aaggactatgaaggagccactctgatgggatgtgagctgaatccacggatcccgtacacg
gaattttctgtcatcattaaaaagcagaaggagatcattaagaagctgatagaaagaaaa
caagctcagattcgaaaagtctaccctgggctttcctgttttaaagatggagttcggcag
attcctatagaaagcattcctggaattcgagaaacaggctggaaatcgagtggaaaagag
agaagcaaagagcccaaagaccctgaccagctttacagcacactcaagagcatcctccag
caggtgaagagccatcaaagcgcttggcccttcatggaaccagtgaagagaacagaagct
ccgggatattatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctc

DBGET integrated database retrieval system