KEGG   Tupaia chinensis (Chinese tree shrew): 102477469Help
Entry
102477469         CDS       T02978                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102477469 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102477469 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102477469 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    102477469 (MGLL)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102477469 (MGLL)
Peptidases [BR:tup01002]
 Serine Peptidases
  Family S33
   102477469 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 377 aa AA seqDB search
MSHRPENSELPGSHTEPGGRNHAQRASSRAVYWPRPPTPRMSRGTQTDVHLADPGVGFSQ
GHRQLLCGLKDSSRMPEGSSPRRTPQNVPYQDLPHLVNPDGQYLFCRYWKPAGTPKALVF
VSHGAGEHCGRYAELAQMLVGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDT
VQKDHPGLPVFLLGHSMGGAIAILTAVERPGHFSGMVLISPLVLTNPESATTFKVLAARV
LNLILPNLSLGPIDSSVLSRNKTEVALYDADPLICRAGLKVCFGTQLLNAVSRVERAMPR
LTAPLLLLQGSADRLCDSRGAHLLQEQEQDTEGERQIYEGAYHVLHKELPEVTSSVFQEI
STWLSQRVGAAGARCPP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaccgtcctgaaaactcagagcttcctggaagccacacagaacccgggggcagg
aaccacgcacagagagcgtctagcagggctgtctactggccgcgccctcccactccgcgt
atgtcaagaggcacacagacggatgtccacttggctgacccgggagtggggttctctcag
ggtcacaggcagcttctttgtggactcaaggactcttccagaatgcccgagggaagctct
cccaggcggaccccccagaacgttccgtaccaggacctccctcacctggtcaaccctgac
ggacagtacctattctgcaggtactggaaacccgcggggacacccaaggccctggtcttc
gtgtcacatggagctggggagcactgtggccgctatgccgagctggcccagatgctggtg
gggttggacctgctggtgttcgcccacgaccacgtcggccacggacagagcgaaggggag
aggatggtggtgtccgacttccacgtctttgtcagggacgtgctgcagcacgtggacacc
gtgcagaaggaccaccccgggctccccgtcttcctcctgggccactccatggggggcgcc
atcgccatcctcaccgcggtggagaggccaggccacttctccggcatggtgttgatctcc
cctctggtcctcaccaacccagagtcggccacgaccttcaaggtcctggctgccagagtg
ctcaacctcatcctgccgaacctatccctggggcccatcgactccagtgtactctctcgg
aataagacggaggtggcgctgtacgacgcggacccgcttatctgccgggcgggcctgaag
gtgtgcttcgggacccagctgctgaacgctgtctcgcgggtggagcgcgccatgcccagg
ctgacggcgcccctcttgctgctccagggctcggccgaccgcctctgtgacagcaggggc
gcccacctgctccaggagcaagaacaagacactgaaggtgagcggcagatctacgaaggt
gcctaccatgtcctgcacaaggagctccccgaggtgaccagctccgtcttccaggagatc
agcacgtggctctcccagagggtgggcgccgcgggagcccggtgcccaccctga

DBGET integrated database retrieval system