KEGG   Tupaia chinensis (Chinese tree shrew): 102478017Help
Entry
102478017         CDS       T02978                                 

Gene name
UCHL1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:tup00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    102478017 (UCHL1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102478017 (UCHL1)
Peptidases [BR:tup01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102478017 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 223 aa AA seqDB search
MQLKPMEINPEMLNKVLARLGVAGQWRFADVLGLEEEALGSVPTPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNACGTIGLIHAVANNQDKLQFEDGSVLKQFLSE
TEKMSPEDRAKCFEKNEAIQAVHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGTSSDDSLLQNAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaagccgatggagatcaaccccgagatgctgaacaaagtgctggcccggctg
ggggtcgccggccagtggcgcttcgcggacgtgctggggctggaggaggaggccctgggc
tcggtgcccacgcctgcctgcgcgctgctgctgctgtttccgctcacggcccagcatgaa
aacttcaggaaaaagcagatcgaagaactgaagggacaggaagtgagccctaaggtgtac
ttcatgaagcagaccatcgggaacgcctgtgggaccattgggctcatccacgcggtggcc
aacaaccaggataagctgcagttcgaggatggatcagtcctcaaacagtttctttctgaa
accgagaagatgtcccctgaagacagagcgaaatgctttgaaaagaacgaggccatccag
gcagtccacgatgcggtggcgcaggaaggccagtgtcgggtagatgacaaggtgaatttt
cattttattctgttcaacaacgtggatggccacctctacgaacttgatgggcggatgcct
tttccggtgaaccatggcaccagctcagacgactccctgctgcagaacgctgccaaggtc
tgcagagaattcaccgagcgcgagcaaggcgaagtccgcttttctgcggtggcgctctgc
aaggcagcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system