KEGG   Tupaia chinensis (Chinese tree shrew): 102478867Help
Entry
102478867         CDS       T02978                                 

Gene name
KAT5
Definition
(RefSeq) lysine acetyltransferase 5
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:tup00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    102478867 (KAT5)
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102478867 (KAT5)
Chromosome [BR:tup03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102478867 (KAT5)
   HAT complexes
    TIP60 complex
     102478867 (KAT5)
    NuA4 complex
     102478867 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 546 aa AA seqDB search
MAEVVSPVPGAGRREPGEVGRARGPPVAEPGAALSPQGEIIEGCRLPVLRRNQDNEDEWP
LAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSR
PGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRST
KRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIP
SAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCL
KYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHK
TLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIE
FSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEI
TSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDW
SKRGKW
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtggtgagtccggtgcccggggcggggcggagggagccaggggaggtgggt
agagcccgaggccccccagtagccgaacctggcgccgcgctgtctccccagggggagata
atcgagggctgccgcctaccggtgctgcggcggaatcaggacaacgaagatgagtggcct
ctggctgagattctgagcgtgaaggacatcagtggtcggaagcttttctacgtccattac
attgatttcaacaaacgcctggatgaatgggtgacccatgagcggctggacctaaagaag
atccagttccccaagaaagaggccaagactcccaccaaaaacggacttcctgggtcccgc
cctggctctccagagagagaggtgccggcctccgcccaggccagcgggaagactttgcca
atcccggtccagatcacactccgcttcaacctgcccaaggagcgggaggccattcccggt
ggcgagcccgaccagccgctctcctccagctcctgcctgcagcccaatcaccgctcaacg
aaacggaaggtggaggtggtttcaccagcaactccagtgcccagcgagacagccccagcg
tcagtttttccccagaatggatcagcccgtagggcagtggcagctcagccaggacggaag
cgaaaatcgaattgcttgggcactgatgaggactctcaggacagctctgatggaatacca
tctgcgccacgcatgactggtagcctggtgtctgaccgtagccacgacgacattgtcacc
cggatgaagaacattgagtgtattgagctgggccgtcaccgcctcaagccgtggtacttc
tctccatacccacaggagctcaccacgttgcctgtcctctacctgtgcgagttctgcctc
aagtatggccgtagcctcaagtgtctacaacgtcacttgaccaagtgtgacctgcgacat
cctccagggaatgagatttatcgcaaaggcaccatctccttctttgagattgatggacgt
aaaaataagagttattcccagaatctgtgtcttttggccaagtgtttcctcgaccacaaa
acattgtactacgacacagatcccttcctcttctacgtcatgactgagtatgactgcaag
ggcttccacattgtgggctacttctccaaggaaaaggagtcaacagaagactacaacgta
gcctgcatcctgaccttgcctccctaccagcgtcggggctacggcaagctgctgattgag
ttcagctatgaactttccaaagtggaagggaaaacagggacccccgagaagcccctctcg
gatcttggcctcctgtcttatcgaagttactggtcccagaccatcctggagatcctgatg
ggtctgaagtcggagagcggggagaggccacagatcaccatcaatgagatcagtgaaatc
accagtatcaagaaggaggatgttatctctaccttgcagtacctcaacctcatcaactac
tataagggccagtatattctcacactgtcagaggacatcgtggatgggcatgagcgagct
atgctcaaacggctccttcgaatcgactccaagtgtctgcacttcactcccaaggactgg
agcaagaggggaaagtggtga

DBGET integrated database retrieval system