KEGG   Tupaia chinensis (Chinese tree shrew): 102478896Help
Entry
102478896         CDS       T02978                                 

Gene name
NEU1
Definition
sialidase 1 (lysosomal sialidase)
Orthology
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Other glycan degradation
Sphingolipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102478896 (NEU1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102478896 (NEU1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102478896 (NEU1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102478896 (NEU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 420 aa AA seqDB search
MTGKRLDTSLPGTASRGTAWRLRALGFGAGRRVPVLAAVFPLLLCLAGFGAGAQDDFSLG
EARGTMEQLLWVSGRQIGAVDTFRIPLITATPRGTLLAFAEARKMSASDEGAKFIALRRS
LDQGSTWSPTAFIVDDGETPDGLNLGAVVCDVETGVVFLFYTLCAHKAGCQVASTMLVWS
KDDGVSWSPPRNLSLDIGTEMFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVYCLLSD
DHGASWRYGSGVSGIPFGQPKRENDFNPDECQPYELPDGSVAINARNQNNYHCHCRIVLR
SYDACDTLRPRDVTFDPELVDPVVAAGAIATSSGIVFFSNPAHPEFRVNLTLRWSFSNGT
SWQKETVQLWPGPSGYSSLAALEGMEGGEQGPQLYVLYEKGRNYCTESISMVKVSVYGSL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacagggaagcgactggacacgtcgctgccgggcactgcgtcccggggcacagcctgg
agactgcgggcgctgggcttcggggcaggccgtagggttccggtgttggccgcggtcttc
ccgctgctgttgtgtctggcgggattcggggctggggctcaggacgacttcagtctgggg
gaggcgcgggggaccatggagcagctgttgtgggtgagcgggaggcagatcggcgccgtg
gacaccttccgcatcccgctcatcacagccactcctcggggcaccctcctcgccttcgcg
gaggccagaaagatgtctgcatcggatgaaggagccaaattcattgccctgcggaggtcc
ctggatcagggcagcacgtggtcccccaccgcgttcattgtagatgacggggagacccca
gacgggctgaacctgggggcagtggtgtgcgatgtggagacgggggtagtattcctgttc
tacaccctctgcgctcacaaggccggctgccaggtggcctccaccatgctggtgtggagc
aaggacgatggcgtctcctggagcccaccccggaacctctccctggatatcggcaccgag
atgtttgcccctggtccgggctccggcattcagaaacagcgggagccacggaagggccgg
ctcatcgtgtgtggccatgggacgctggagagggacggggtgtactgtctcctcagcgat
gaccacggtgcctcctggcgctatgggagtggggtcagcggcatcccctttggccagccc
aagcgggaaaacgatttcaaccctgacgaatgccagccctacgagctcccagatggctca
gttgctatcaacgcccggaaccagaacaactaccactgccactgccggatcgtcctccgc
agctacgacgcctgtgataccctgcggccccgcgacgtgaccttcgaccccgagctcgtg
gaccccgtggtcgccgcgggagccatagccaccagctccggcatcgttttcttctctaac
ccagcccatccagagttccgagtgaacctgaccctgcgctggagcttcagcaatggcact
tcgtggcagaaggagacggtccagctgtggccagggcccagtggctactcgtccctggca
gccctggagggcatggagggaggggagcagggcccgcagctctatgtgctgtatgagaag
ggccggaactactgcacagagagcatctccatggtcaaggtcagcgtctacgggtcactc
tga

DBGET integrated database retrieval system