KEGG   Tupaia chinensis (Chinese tree shrew): 102479502Help
Entry
102479502         CDS       T02978                                 

Gene name
KAT6A
Definition
(RefSeq) lysine acetyltransferase 6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:tup00001]
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102479502 (KAT6A)
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102479502 (KAT6A)
Chromosome [BR:tup03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102479502 (KAT6A)
   HAT complexes
    MOZ/MORF complex
     102479502 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1730 aa AA seqDB search
MLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGR
PKNRLKKQNTVSKGPFSKVRTGPGRGRKRKITLSSQSASSSEEGYLERIDGLDFCRDGSV
PLKFNKKTKGLIDGLTKFFTPSPDGRKARGEVVDYSEQYRIRKKGSRKSSTSDWPTDNQD
GWDGKQESEERLFGSQEVMTEKDMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYE
IHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISV
FEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHC
QQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSV
ILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMA
KLQLNLRPVDVDPECLRWTPVIVSNSVVSEEEEEAEDGENEEPQCQERELEASVPSMSRE
SKEQDSYSSVESEKKPEVLAPASSTRLNKQVLPRDSLPANSQPSRRGRCGRKNRKAQERF
GDKDSKLLLDETSSTPQEQYGECEEKSEASQEQFTESEEQLVAPVEQPGQDGKPDLPRRR
LSEGVELWRGQLKKSPEGPKCRLPEGNDRLPRRYSDGDRALLRGFSESSEEEEEPESPRS
SSPPILTKPTLKRKKPILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMP
RLEPTFEIDEEEEEEDENELFPRRYFPLPSQDVLRCRSSSKRKSKDEEEDEESDDADDTP
ILKPVSLLRKCDMKNSSLEPDTSTPMKKKKGWPKGKSRKPVHWKKRPGRKPGFKLNREIM
PVSTPECISEPIVPIPKAGRKPRIQENEETVESKEDLPLSEERKEEMHVEAEEAEEGEEE
DTAGSEVRAASPVDSSNSPEPEPKEPEVEVEEEEEEKPRLAEEQRQSEEEQPELEEQEPE
EEDEATVETSQNDDHDADDEDDGQLGSARKKELEEQPAREDAKDEPGGQEAFLDADTQNS
RETAKDKDDTEPESEEEQPSHETSVVSEHMPGSEDDHEEDSNTKEELIELKEEEEIPHSE
LDLETVQAVQSLTQEESNEHEGAYQDCEETLAACQTLQSYTQADEDPPMSMVEDCQASEH
NSPISSVQSHPSQSVRSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVS
DHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLT
QNSCVVTQQMASMGSSCSMMQQSGVQPAANCSIKSPQSCVVERPPSNQQPPPPPPPQQQP
QPPPQPQPQPQQQPAPQPPPPQPQPPQPQPPPQPQQPPPPPPQQQPPLSQCSMNNSFTPA
PMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHS
PAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSA
TNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPPAVAMQAGPRALAVQ
RGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQ
MGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 5193 nt NT seq  +upstreamnt  +downstreamnt
atgctcttttgcgattcatgtgaccgaggttttcacatggaatgttgtgatccaccactc
acccggatgccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacga
aaacttctacaaaagaaggcagcacagataaaacgacgctatgctaatccaataggacgt
cccaaaaacaggttaaagaaacaaaacacggtatcaaaaggtcccttcagcaaagttcga
actggccctggaaggggccgaaaacggaaaatcactctctccagccagtcagcatcatca
tcagaagagggatatttagagcgaatagatggcttggacttctgcagagatggcagtgtc
cccttgaagttcaacaagaaaaccaaagggcttattgatggccttaccaaattctttacc
ccttccccggatgggcggaaagcacgaggggaagtggtagactactctgagcaatacaga
atcaggaaaaaaggcagcagaaaatcaagcacttcagattggcctacagacaatcaggat
ggctgggatggcaagcaagaaagtgaggagcggctcttcgggagccaggaagtcatgacc
gagaaagatatggaattatttcgtgatatccaagaacaagcgctgcagaaagttggagtg
actggtccccctgatccacaagttcgctgtccctctgtcattgagtttgggaaatatgaa
attcacacctggtactcctccccatatcctcaagaatactcaaggttgcctaaattgtat
ctttgtgaattctgtctaaaatatatgaaaagtagaactattctacagcagcacatgaag
aaatgtggttggttccatcctcctgccaatgagatttaccgaaaaaataatatttctgtc
tttgaggttgatgggaacgtgagtaccatttattgtcaaaacctgtgtctcttggcaaag
ttgtttctcgaccacaaaacactctattatgacgtggagccatttcttttttatgtacta
acacagaatgatgtcaagggctgccaccttgttggctacttttctaaagagaagcactgc
cagcagaaatacaatgtttcctgtataatgattcttccccagtaccagcgtaagggctat
ggcaggtttctcatcgatttcagttacttgttgtcaaagcgtgaaggccaagcagggtct
ccggagaagccgctgtccgatctagggcgcctttcctacatggcttactggaaaagtgtc
atactggagtgcctttatcaccaaaatgacaaacagatcagcattaagaagttaagcaag
ctgactggaatctgcccgcaggacataacttctacactccaccacctacggatgctggac
ttccgcagtgaccaatttgtgattatccgccgggaaaaactgatccaggaccacatggca
aagcttcagctgaatttgcggcctgtggatgtggacccagagtgtctacgctggactcct
gtcatcgtgtccaactctgtggtctcggaagaggaggaagaggctgaggacggagagaac
gaagagccgcagtgccaggaaagggagctagaggccagtgttccatccatgtctcgggag
agcaaagaacaagattcttattcttcagtagaaagtgaaaagaaaccagaagttctggct
ccggccagttctacacgcttgaataaacaagtccttccccgcgatagtctccctgcaaat
agtcagccatcacggcgggggcgctgcgggaggaaaaacagaaaagcccaggaacgtttt
ggtgacaaagattccaaactcctcttggacgagacatcatccactcctcaggagcagtat
ggggaatgcgaggagaagtcagaggcttcccaggaacagttcactgaaagtgaagaacag
ttggtggcccccgtggagcagccaggccaggatgggaagccagacctgcccaggagaaga
ctgagcgagggggtggagctgtggcggggacagctgaagaagagccccgagggtccgaag
tgcaggttaccagaagggaatgacagactgccccgacggtacagtgacggcgatagggct
ctcctcaggggcttcagtgagagcagcgaggaggaggaagagcccgaaagccctcggtcg
agctcgccacccattctcacaaaacccacgttgaagcgaaagaaaccaattcttcacaga
aggaggagagtccggaagcgcaaacaccacaatagcagtgtggtcacagaaacgatctcc
gagaccaccgaggtcttagatgaaccttttgaagactctgactcggagaggccaatgccg
agattagaacccacatttgagattgatgaagaagaagaggaagaggatgaaaacgagctc
tttccgagaagatacttccctttgccatcacaggatgttctcaggtgccggtcgtcctct
aagaggaagtctaaagatgaggaggaagatgaggagtcggatgacgccgacgacactcct
atcctaaagccagtgtctctcttgcgaaaatgtgatatgaagaattcctcacttgagcca
gatacttccacacccatgaaaaagaaaaaggggtggcccaagggcaagagccgcaaacca
gtccactggaagaaaagacccgggcggaagccaggatttaagctgaatcgggaaatcatg
cctgtttctactccagaatgcatctctgagcccatcgtccccattcctaaggctggacgc
aaacccagaattcaagagaatgaagaaactgttgaatcaaaagaagacttgcctttatcc
gaagaaaggaaggaagagatgcatgtggaagcagaagaggctgaagagggcgaagaagag
gacacagctggcagtgaggtcagagcagcttcccccgtggacagcagcaacagccctgag
ccggagcccaaggagccggaggtggaggtggaggaggaggaggaggagaagccccgcctt
gcagaggagcagaggcagtcggaggaggagcagccagagctggaagagcaggagccagag
gaggaagatgaggccactgtggagacaagccagaatgacgaccatgacgcagacgatgag
gacgacggccagctggggtctgcgaggaagaaggagctcgaggagcagcctgccagagaa
gacgccaaggacgagcccggtggccaggaggcttttttagacgcggacacacagaacagt
agggagaccgcaaaggacaaagacgacacagagccggagtctgaggaggagcagccttcc
cacgagacgtccgtggtgtccgagcacatgccaggatctgaagatgatcacgaagaggat
tcgaacacgaaggaagagctgatagaattaaaagaggaggaagagattccccacagcgag
ctggacctggagaccgtgcaggcagtgcagtccctgacgcaggaggagagcaacgagcac
gagggcgcctaccaggactgtgaagagacgctggccgcctgtcagaccctgcagagctac
acgcaggctgacgaggaccctcccatgtccatggtcgaagactgccaggcttcggaacac
aacagccccatctcctctgtccagtctcatcccagccagtcggtccgttcggtcagcagt
cccaacgtgcctgccctggagagcggttacacccagatcagcccggagcagggttccctg
tccgcgccctctatgcagaacatggagaccagccccatgatggatgtgccttccgtatca
gaccactctcagcaggtggtggacagtggcttcagcgacctgggcagcatcgagagcacc
acagagaactacgagaacccgagcagctacgactccaccatgggcggcagcatttgtggg
aacagctcttctcagagcagctgctcctatggcggcctgtcgtcctccagcagcctcacc
cagaacagctgcgtggtcactcagcagatggccagcatgggcagcagctgcagcatgatg
cagcagagcggcgtgcagcctgccgccaactgcagcatcaagtcacctcagagctgcgtg
gtggagaggcctcccagcaaccagcagccaccgccaccaccaccaccgcagcagcagcca
cagccacccccgcagccacagccgcagccacagcagcagccagcaccgcagcctccacca
ccccagccgcagccgccgcagccgcagccaccgccgcagccccagcagccgccgccgccc
ccgccccagcagcagccaccgctgtcacagtgcagtatgaacaacagtttcactccagcg
cctatgatcatggagatcccggagtcggggagcactgggaacatcagtatctacgagagg
attcccggggactttggtgccggcagctactcccagccgtcagccaccttcagcttggcc
aagctgcagcagctgaccaacaccattatggaccctcatgccatgccttatagccattct
cctgccgtgacttcctatgcaaccagcgtctctctgtcgaacacaggactggctcagcta
gctccatctcacccattggccgggacccctcaagcacaagccaccatgacgccaccccca
aacttggcatccacgaccatgaacctcacatcacctctgctacagtgcaacatgtccgcc
accaacattggcattcctcacactcagaggttgcaggggcagatgccagtcaaagggcac
atttccatccgctccaaatctgcaccactgccctccgcggctgcccaccagcagcagctg
tatggccgcagcccaccagcagtcgccatgcaggccggccctcgtgcactggctgttcag
cgtggcatgaacatgggggttaacttaatgcccacccccgcctataatgtcaattccatg
aatatgaacaccttgaatgccatgaacagctatcggatgacgcagcccatgatgaacagc
agttaccatagtaaccctgcctacatgaaccagacagcacagtatcctatgcagatgcag
atggggatgatggggagccaggcctatacccagcagcctatgcagccaaaccctcatggc
aacatgatgtacactggcccctcccatcacagctacatgaacgctgctggcgtgcccaag
cagtcgctcaacggcccttacatgaggagatga

DBGET integrated database retrieval system