KEGG   Tupaia chinensis (Chinese tree shrew): 102481039Help
Entry
102481039         CDS       T02978                                 

Gene name
CKM
Definition
creatine kinase, muscle
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102481039 (CKM)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102481039 (CKM)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102481039 (CKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 381 aa AA seqDB search
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTPDLYKKLRDKETPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT
EKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLT
HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGQSIDDMIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcggcaacacccacaacaagttcaagctgaactacaagcctgaggaggagtac
ccggacctcagcaagcataacaaccacatggccaaggtcctgacccctgacctctacaag
aagctgcgggacaaagagactccatctggcttcaccctggacgatgtcatccagacaggt
gtggacaacccaggtcaccccttcatcatgaccgtgggctgtgtggccggtgacgaggag
tcctacgaggtattcaaggatctcttcgaccccatcattcaggaccggcacgggggctac
aaacccaccgacaagcacaagaccgacctcaaccacgagaacctcaagggtggagacgac
ctggaccccaactacgtgctcagcagtcgcgtccgcactggccgcagcatcaaggggtac
accctgcccccccactgctcccggggggagcgccgggccgtggaaaaactctccgtggaa
gccctcaacagcctgacaggcgagttcaaggggaagtactaccccctgaagagcatgacg
gagaaggagcagcagcagctcatcgacgaccacttcctgtttgacaagcccgtgtccccg
ctgctgctggcctcaggcatggcccgggactggcccgatgcccgtggcatctggcacaac
gacaacaagagcttcctggtgtgggtcaacgaggaggaccacctccgggtcatctccatg
gagaaggggggcaacatgaaggaggttttccgccgcttctgcgtggggctgcagaagatc
gaggagatctttaagaaagcgggccaccccttcatgtggaacgagcacctgggctacgtg
ctcacctgcccatccaacctgggcactgggctgcgtgggggcgtgcacgtcaagctgacg
cacctgagcaaacaccccaagttcgaggagatcctcacccgtcttcgcctgcagaagcgg
ggcacaggtggcgtggacaccgctgccgtgggctcagttttcgacgtgtccaacgccgac
cgcctgggctcgtccgaggtagaacaggtgcagctggtggtggacggtgtgaagctcatg
gtggagatggagaagaagctggaaaagggccagtccatcgacgacatgatccctgcccag
aagtag

DBGET integrated database retrieval system