KEGG   Tupaia chinensis (Chinese tree shrew): 102481533Help
Entry
102481533         CDS       T02978                                 

Definition
sperm acrosome-associated protein 5-like
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102481533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 160 aa AA seqDB search
MQSWGTVVVTLAIVMVATVDAKIYERCELARKLEKAGLNGYRGYTIGDWLCMAHYESGFD
TSFVNHNPDGSSEYGIFQLNSAWWCDNGVTPSQNLCHMDCRDLLNRHILDDILCAKRIVS
SHNSMTAWNSWTKHCSGHDLSGWIKGCDMNVKTDPKKINS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctggggcactgtggtagtgaccttggccatagtgatggttgccactgtggat
gccaagatctacgagcgctgtgagctggcaagaaagctggagaaagcaggcctcaatggc
tacaggggctacaccattggagactggctatgcatggcacactatgagagtggctttgat
acctccttcgtgaatcacaatcctgacggcagcagtgaatatggcattttccagctgaac
tctgcctggtggtgtgataatggtgtcacaccttcccagaatctctgccacatggattgt
cgtgacctgctcaaccgccatattctggatgacatcttgtgtgctaagcggattgtgtcc
tcacataacagtatgactgcctggaactcgtggaccaagcactgttctggccatgattta
agtggatggatcaaggggtgtgatatgaatgtgaaaactgacccaaagaaaattaattca
tga

DBGET integrated database retrieval system