KEGG   Tupaia chinensis (Chinese tree shrew): 102482233Help
Entry
102482233         CDS       T02978                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102482233 (GLS2)
   00330 Arginine and proline metabolism
    102482233 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102482233 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102482233 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    102482233 (GLS2)
   04727 GABAergic synapse
    102482233 (GLS2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102482233 (GLS2)
   05206 MicroRNAs in cancer
    102482233 (GLS2)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102482233 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 600 aa AA seqDB search
MRSMRALQNALGRAGSHCRRGGWGHLSRSPLLGGGVRHHLSEAAAQGRESPHSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMHRMVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEFMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSXSCGMYDFSGQFAFHVGLPAKSAVSGAIL
LVVPNVMGMMCLSPPLDKLGNSHRGISFCQKLVSLFNFHNYDNLRHCARKLDPRREGGEV
RNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIEAC
KVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgagggctctgcagaatgcgcttggccgggctggcagtcactgccggcgg
ggaggctggggtcacctgagccggagccccctccttggcgggggcgtccggcaccacctc
agtgaggccgcggcgcagggcagagagtcgccgcacagccatcagccgcagcaccaggat
catgattcctcagagagtggtatgctgtcccgactgggtgatctgctcttctacactatt
gctgagggacaggaacgaatccctatccacaagttcactactgcactgaaggccaccgga
ctgcagacatcagatccccggctccgggactgcatgagccagatgcaccgcatggtgcaa
gagtccagcagtgggggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcatccctgattttgaggagttc
acgggccatgtggatcgcatctttgaagatgccaaagagctcactggaggcaaagtggcg
gcctacatccctcagctggccaagtcaaacccagacctgtggggcgtctccctgtgcact
gtggatggtcagcggcactctgtgggacacacaaagatccctttctgcctgcagtcctgt
gtgaagcccctcacctacgccatctccataagtacgctgggcactgactacgtgcacaag
tttgtgggcaaggagcccagtggcctgcgctacaataagctctccctcaatgaagaagga
atcccccataaccccatggtcaatgctggtgccattgtcgtcagctccctgatcaagatg
gactgtaacaaagctgagaagtttgattttgtgctgcaatacctgaacaaaatggctggg
aatgaattcatgggtttcagcaatgccacattccagtcagagaaggaaaccggggatcgg
aactatgccattggctattatctcaaagaaaagaagtgcttccctaagggggtggacatg
atggctgcccttgatctctacttccagctgtgctccgtggaagtcacttgtgaatcaggc
agtgtcatggcagccacccttgccaatggcgggatctgccccatcacaggcgagagcgtg
ctgagcgccgaagcagtgcgcaacaccctcagcngttcctgcggcatgtacgacttctct
ggccagtttgccttccacgtgggcctgccagccaagtcagctgtgtcgggagccatcctc
ttggtggtacccaatgtcatgggaatgatgtgtctgtcacctccactggataagctgggg
aacagccacaggggcatcagcttctgccagaaactggtgtctctcttcaatttccacaat
tacgacaacctacggcattgtgcacggaagttagacccacgacgcgaagggggagaagtt
cggaacaagactgtggtgaacctgttatttgctgcctacagtggcgatgtctcagctctc
cgaaggtttgctttgtcagccatggatatggaacagaaggactatgactctcgcacagct
ctgcatgttgctgcagcggaaggacatattgaagttgttaaattcctgatcgaggcttgc
aaagtgaatccttttgtcaaagataggtggggcaatattcccctggatgatgctgtgcag
ttcaaccacctggaggtggtcaaactgcttcaagattaccaagactcctacacactctct
gagactcaggctgaggcagcagctgaggccctttccaaagagaacttagagagcatggtg
tga

DBGET integrated database retrieval system