KEGG   Tupaia chinensis (Chinese tree shrew): 102483009Help
Entry
102483009         CDS       T02978                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102483009 (ART1)
Cellular antigens [BR:tup04090]
 Proteins
  102483009 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 241 aa AA seqDB search
MSLLLASLVLLGALQAQSHPISPRDLFSQETPLDMAPASFDDQYAGCTVAMTAALPDLNL
TEFQTNKVYAEGWALALQLLSRGQTLPRCRQVFRGVHGLRFRPAGPGATVRLGGFASASL
KNVAAQQFGEDTFFGIWTCLGAPIQGYSFFPGEEEVLIPPFETFQVINASRPAQGPARIY
LRALGKSSTYNCEYIKDRCKSGPCHLDNSATGQGHPSAGWSLLLLPWLLAVGAFPESPGL
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctccttgcgtccctggtgctcctgggagcacttcaggcccaaagccacccc
atttcaccgcgagacctcttctctcaagaaacgcccctggacatggcccccgcctccttc
gacgaccagtacgccggctgcacagtggccatgaccgcggcgctcccggacctcaacctc
acggagttccagaccaacaaagtgtacgcggagggctgggcgctggccctgcagctgctg
agcaggggccagaccctgccccgatgccgccaggtgttccgaggggtgcacggtctgcgc
ttccggccagcagggccaggggccaccgtgaggctggggggcttcgcctcagcgtccctg
aagaacgtagcagcccagcagtttggtgaggacaccttcttcggcatctggacctgcctc
ggggcccctatccagggctactcctttttccctggggaggaggaagtgctgatccccccc
tttgagaccttccaggtgatcaacgccagcagaccggcccagggccctgcccgcatctac
ctgcgggcgctgggcaagagcagcacatacaactgcgagtacatcaaagacaggtgcaag
tctggaccctgccatctggataattcagccacggggcagggccacccctctgcaggctgg
tccctcctgctactgccctggctccttgcagtgggggcctttcctgagagcccaggcctc
ctctga

DBGET integrated database retrieval system