KEGG   Tupaia chinensis (Chinese tree shrew): 102484022Help
Entry
102484022         CDS       T02978                                 

Gene name
TGM6
Definition
transglutaminase 6
Orthology
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102484022 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 784 aa AA seqDB search
MNQTSPTSPFTKSKRTPEKWEFSKAVQEPSPASGSLKTQKPHEPFHHPSHDLKPRDDKLP
KEGKQGKRKNKERYLGDDGDGIRVTKVDWQRSRNGAAHHTQEYPCLELVVRRGQLFSLTL
ELSAAMDSEETFIFTVETGPEASEALHTKAVFQTSELEMSDTWTAAKDTQTENTVTVSLA
SPPDAVIGRYLLSTRVSSRCKHRDRKLGEFILLFNPWCPEDDVFLASEEERQEYVLNDSG
IIFRGVEKRIRAQGWNYGQFEEDILNICLSILDRSPSHQDSPATDVSCRHDPIYVTRIIS
AMVNSNDDRGVVQGQWQGKYGGGTSPLHWRGSVATLQKWFKGRSKPVKYGQCWVFAGVLC
TVLRCLGIATRVVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFAR
KDLGPSYNGWQVLDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYVTW
LWNEDESRERVYSDTKKIGRCISTKAVGSDSRVDITSLYKYPEGSRKERQGDSKAVKKLF
SVEASGRRTRLRRAGGRGLWRDDLLEPATKPSITGKFKVLEPPMLGQDLKLALCLANLTS
RAQRIRVNLSGATILYTRKPVAEILHESHAVRLGPQEEKKIPIMISYSQYKEDLTEDKKI
LLAAMCLVTKGEKLLVEKDITLEDFIIIKVLGPAVVGVVVAVEVTVVNPLLEKVKDCVLI
VEGSGLLRGQLSLDVPSLEPQERASVQFDITPSKSGPRQLQVDLVSSHFPDIKGFVVIHV
ATAK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacgtccccaacatctccattcacgaaaagtaaaagaactccagaaaaatgg
gaattttccaaggcagttcaagagccctcacctgcaagtggcagccttaaaacccagaag
cctcacgagccgtttcaccatccatcacatgacctcaagccaagagatgacaagcttccc
aaagagggcaagcagggcaagcggaagaacaaggagagatacctgggagatgatggcgat
gggatcagagtcaccaaagtggactggcagaggtcgaggaatggcgctgcccaccacacc
caggagtacccctgccttgagctggtggttcgcaggggccaattgttcagcctcacgctg
gagctgagtgcagccatggacagcgaggagacgttcatcttcacggtggagacaggacca
gaagcttccgaggccctccacaccaaagctgttttccagacatcggagctggagatgagc
gatacctggacagcagcgaaggacactcagacagagaacaccgtgacggtcagccttgcc
agccctcccgacgctgtcattggtcgttacctgctgagcaccagggtgtcttctcgctgc
aaacaccgtgaccggaagctgggcgagtttattctccttttcaacccatggtgcccagag
gacgacgtgtttctggcttcagaggaggagagacaggagtacgtgctcaatgacagtggc
atcatcttccgaggcgtggagaagcgcatccgagcccagggctggaactacgggcagttt
gaagaggacatcctgaacatctgcctctccatcttggaccgaagccccagccaccaagac
agcccagccactgatgtgtcctgccgccatgaccccatctatgtcaccaggatcatcagt
gccatggtgaacagcaatgatgaccggggtgtggtgcaaggccagtggcagggcaaatac
ggtggtggcaccagcccactgcactggcgtggcagcgtggccaccctgcagaagtggttc
aagggcaggtccaagccagtcaagtacggccagtgctgggtcttcgctggagtcttatgc
acagtccttaggtgcttggggatcgcaacacgggtcgtgtccaacttcaactcggcccat
gacacagacaggaacctgagtgtggacaaatatgtggactccttcgggcggaccctagag
gacctgactgaagacagcatgtggaatttccacgtctggaatgagagctggtttgcccgg
aaggatctaggcccctcttacaatggctggcaggttctggatgccactccccaggaggaa
agcgaaggtgtgttccggtgcggcccagcctcggtcaccgccatccgtgagggcgacgtg
cacttggcccacgacggccccttcgtgtttgcggaggtcaatgcagactatgtcacctgg
ctgtggaatgaggatgagagccgggagcgcgtgtactcagacaccaagaagattggaaga
tgcatcagcaccaaggcagtgggcagcgactcccgtgtggacatcaccagcctctacaaa
tatccggaagggtcccggaaggagaggcagggggatagcaaggctgtgaagaagctgttt
agtgtggaagcctctggaaggaggacccggctccgcagggcggggggccgtggtctctgg
cgtgatgacctcctggagccagccaccaagcccagcattaccggcaagttcaaggtgcta
gagccacccatgctgggccaggacctgaagctggccttgtgcttggccaacctcacctcc
cgggcccagcgcatccgagtcaacctgagcggggccaccatcctctacacccgcaagccg
gtggcagagatcctacacgaatcccatgcagtgaggctggggccgcaagaagagaagaag
atcccaattatgatatcttattctcagtataaagaagacctgacagaagataagaagatc
ctgttggctgccatgtgccttgtcaccaaaggagagaagctcctggtggagaaggacatt
actctggaggatttcatcatcatcaaggtgctgggcccagccgtggtgggagtggtagtt
gcggtggaagtgacggtggtcaaccctctcttggagaaagtgaaggactgtgtgctgata
gtggagggaagcggccttcttcgaggacaactcagcttagacgtgcccagcctggagcct
caggagagggcctcggtccagtttgacatcaccccctccaaaagtggcccaagacaacta
caagtagacctcgtcagctcccacttcccggacatcaagggcttcgtggtcatccatgtg
gccacagccaagtga

DBGET integrated database retrieval system