KEGG   Tupaia chinensis (Chinese tree shrew): 102484800Help
Entry
102484800         CDS       T02978                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04024  cAMP signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04110  Cell cycle
tup04310  Wnt signaling pathway
tup04330  Notch signaling pathway
tup04350  TGF-beta signaling pathway
tup04520  Adherens junction
tup04630  Jak-STAT signaling pathway
tup04720  Long-term potentiation
tup04916  Melanogenesis
tup04919  Thyroid hormone signaling pathway
tup04922  Glucagon signaling pathway
tup05016  Huntington's disease
tup05152  Tuberculosis
tup05161  Hepatitis B
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  HTLV-I infection
tup05167  Kaposi's sarcoma-associated herpesvirus infection
tup05168  Herpes simplex infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05206  MicroRNAs in cancer
tup05211  Renal cell carcinoma
tup05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102484800 (CREBBP)
   04330 Notch signaling pathway
    102484800 (CREBBP)
   04350 TGF-beta signaling pathway
    102484800 (CREBBP)
   04630 Jak-STAT signaling pathway
    102484800 (CREBBP)
   04066 HIF-1 signaling pathway
    102484800 (CREBBP)
   04068 FoxO signaling pathway
    102484800 (CREBBP)
   04024 cAMP signaling pathway
    102484800 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102484800 (CREBBP)
  Cellular community - eukaryotes
   04520 Adherens junction
    102484800 (CREBBP)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    102484800 (CREBBP)
   04919 Thyroid hormone signaling pathway
    102484800 (CREBBP)
   04916 Melanogenesis
    102484800 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    102484800 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102484800 (CREBBP)
   05206 MicroRNAs in cancer
    102484800 (CREBBP)
   05203 Viral carcinogenesis
    102484800 (CREBBP)
   05211 Renal cell carcinoma
    102484800 (CREBBP)
   05215 Prostate cancer
    102484800 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    102484800 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    102484800 (CREBBP)
   05166 HTLV-I infection
    102484800 (CREBBP)
   05164 Influenza A
    102484800 (CREBBP)
   05161 Hepatitis B
    102484800 (CREBBP)
   05168 Herpes simplex infection
    102484800 (CREBBP)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102484800 (CREBBP)
   05169 Epstein-Barr virus infection
    102484800 (CREBBP)
   05165 Human papillomavirus infection
    102484800 (CREBBP)
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102484800 (CREBBP)
Transcription factors [BR:tup03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102484800 (CREBBP)
Chromosome [BR:tup03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102484800 (CREBBP)
Mitochondrial biogenesis [BR:tup03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102484800 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX zf-TAZ DUF902 Bromodomain ZZ Creb_binding KIX_2 RNase_H2-Ydr279
Motif
Other DBs
NCBI-GeneID: 102484800
NCBI-ProteinID: XP_014444597
Position
Un
AA seq 2314 aa AA seqDB search
KNQTGTSADFGSFFDLENDLPDELIPNGGELGLLNSGNLVSDAASKHKQLSELLRGGSGS
SINPGVGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLNQGDSSAPSLPKQAAST
SGPTPPASQALNQQAQKQVGLVTSSPATSQPGPGICMSANFSQAHPGLLNNSGHGLVSQA
QQGQAQVMNGSLGAAGRGRGAGMTYPAPAIQGATSSVLAETLTQVSPQMAGHAGLNTAQA
GGLPKISMTGTTSPFGQPFSQAGGQQMGATGVNPPLPSKQSMVNSLPTFPTDIKNTSVTN
VPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACS
LPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRN
QQTILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSSMQRAYAALGLPYMNQTQTQLQ
PQVPGQQPAQPQAHQQMRSLNPLGNNPMNIPAGGITADQQNLISESALPTALGATNPLIN
DSANSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKD
RRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQP
TLPAPGTQPPGIPQAQSVRPPKGPLPLAVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRA
ASPMSHSVQMSSLGSVPGMAISPSRMPQPPNMMGTHANSMLAQAPAQSQFLSQNQFPSSS
GAMSVSSVGMGQPTAQTGVSQGQVSGAPLPNPLNMLGTQASQLPCPPVTQSPLHPTPPPA
STAAGMPSLQHPTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQA
AAQAQVTPQPPTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQAAASIDNRVPTPSSVAS
AETTSQQPGPEGPVLEMKAEVQTEDSEPDPGESKGESRSEMMEEDLQGSSQVKEEMDTTE
QKSEPMDVDEKKPEIKVEAKEEEESSANGAAAQSTSPSQPRKKIFKPEELRQALMPTLEA
LYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLM
FNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCT
IPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPF
VDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKSGRPRKENKFSAKRLQTTRLGNHLED
RVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFE
EIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEY
VKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYK
DIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQG
DSKNAKKKNNKKTNKNKSSISRANKKKPSVPNVSNDLSQKLYATMEKHKEVFFVIHLHAG
PVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ
DRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQ
SKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCK
QLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQTQPRLQQAQLMRRRMATMNT
RNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSVTRTQPPPAAV
EAARQIEREAQQQQHLYRVNINNSMPPGRTGMGAPGNQMAPVGLNVPRPSQVSNTVMPSM
PPCSRPGASHPQQQQVLNTHKSNPQLMAAFIKQRTAKYVANQPGLQPQPGLQSQPSLQPQ
PAMHQQPGLQNLNAMQAGVPRPGVPPQQQTMGGSCYSSSSSSSNSSSRSRRKNQGGGMAG
HGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQMGQLGQIGQPGLGADGTPNIQ
QALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAP
VQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVSMASSIDQGHLGNPEQSAM
LPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 6945 nt NT seq  +upstreamnt  +downstreamnt
aagaaccagacgggcacttctgcagattttggatcattttttgacttggaaaatgatctt
cccgatgagctgattcccaacggaggagaattgggccttttaaacagtgggaaccttgtt
tcagatgctgcttccaaacataaacaactgtcggagcttctgcgaggaggcagcggctct
agtatcaacccaggagtaggaaatgtgagcgccagcagccctgtgcagcagggccttggg
ggccaggctcaagggcagccgaacagtgcaaacatggccagcctgagtgccatgggcaag
agccctctgaaccagggagattcttcagcccctagcctgcccaagcaggcagccagcacc
tctgggcccactccccctgcttcccaagcactgaatcagcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagcctggccctgggatctgcatgagtgctaac
tttagccaggcccacccaggcctcctcaataactctggccacggcttggtgagtcaagcc
cagcaaggccaggcgcaagtcatgaacggatctcttggggctgctggcagaggaagggga
gctggcatgacgtaccctgcccctgccatccagggggccacaagcagcgtgctggctgag
accttaacacaggtttccccgcaaatggccggccatgcgggactgaacacggcgcaggca
ggaggcttgcccaagataagtatgactggtaccacaagtccatttggacaacccttcagt
caagctggagggcagcagatgggagccacgggagtgaaccccccgctgcccagcaagcag
agcatggtcaatagtttgcctaccttccccacagatatcaagaatacttcagtcaccaac
gtgccaaacatgtctcagatgcaaacatcagtgggaattgtccctacacaagcaattgca
acgggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttctactg
cttcacgctcataagtgtcagcgacgagaacaagcgaatggagaggttcgggcctgctcg
ctcccgcactgtcgaaccatgaaaaatgtgttgaatcacatgacgcattgtcaggctggg
aaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaactatcctggggtctccagctagtgggattcaaaacacgattggctctgttggc
acgggacagcagaatgctgcttcgttaagtaaccccaaccccatcgaccccagctccatg
cagcgtgcctatgctgctctcggactcccctacatgaaccagacccagacgcagctgcag
cctcaggttcctggccagcaaccagcacagcctcaagcccaccagcagatgaggtctctg
aaccccctgggaaataaccccatgaacattccagcaggaggaataacagcagatcagcag
aacctgatatcagaatcggctcttccaactgcccttggggccacaaacccactgataaat
gacagcgccaactctggtaacattggaagcctcagcaccatccccacagccgcacctccg
tctagcaccggcgttcggaaaggctggcacgaacacgtcactcaggacctgcggagccat
ctagtgcataaacttgtccaggccatcttcccgacgcctgaccctgcagctctgaaggac
cgccgcatggagaacctggtagcctacgcaaagaaagtagaaggggacatgtacgagtct
gccaacagcagggatgaatactatcatttgttagcagagaaaatctacaagatacagaaa
gaattagaagaaaaacggaggtcacgtttacataagcaaggcatcttgggtaaccagccg
accttaccagccccaggaacccagccccctggtattccgcaggcacagtctgtgagacct
ccaaagggccccctgcctctggcagtgaatcgcatgcaggtctctcaagggatgaattca
tttaaccccatgtccttggggaatgtgcagttgccacaggcgcccatgggcccgcgggca
gcctctcccatgagccactctgtgcagatgagcagcctgggctccgtgccagggatggcc
atttcaccttcccgcatgccgcagcctccgaacatgatgggcacccacgccaacagcatg
ctggcccaggcccctgctcagagccagttcctgtcgcagaaccagttcccatcatccagc
ggggccatgagcgtgagcagcgtgggcatggggcagccgacagcccagacaggcgtgtcg
cagggacaggtgtctggggctcctcttcccaaccctctgaacatgcttgggacacaagcc
agccagctgccgtgcccaccagtgacacagtcaccgctgcaccccacgccaccacctgcc
tccacggctgccggcatgccatctctgcagcacccaacgccacctgggatgactcctccc
cagccagcagctcctactcagccgtctactcccgtttcgtcttccggacagactcctacc
ccaacccctggctcagtgcccagcgctacccagacccagagtactccaacagtccaggca
gcagcccaggcccaggtgaccccacagcctccaaccccagtccagcccccatctgtggcc
acccctcagtcatcccagcagcagccaacgcctgtgcacacccagcctcctggcacaccg
ctttctcaggcagcagccagcattgataacagggtccccaccccttcctcggtggccagc
gccgaaaccacttcccaacagccaggccctgagggacctgtgctggaaatgaaggctgag
gtccagactgaggactccgagcctgatcctggcgaatccaagggggagtccaggtctgag
atgatggaagaggatctacagggatcttcccaagttaaagaagaaatggacacaacagag
cagaaatcagaaccgatggacgtggatgagaagaaacctgaaataaaagtagaagctaaa
gaggaagaagagagcagtgctaacggtgcggccgctcaatcgacatctccttcacagcca
cgcaaaaaaatctttaaaccagaggagttacgccaggctctgatgccaaccttggaagca
ctgtatcgccaggacccagagtctttaccttttcgacagcccgtagatcctcagctcctg
ggaatcccagattatttcgacatcgtgaagaatcccatggacctttctaccattaagcga
aagctagatacagggcaataccaggagccctggcaatacgtggacgacgtatggcttatg
ttcaacaacgcatggctctacaaccgtaagacctcccgggtctacaagttttgcagtaaa
cttgcagaggtgtttgaacaagaaattgaccctgtcatgcagtcccttggatattgctgt
ggacgcaagtatgagttctccccccagaccctgtgctgctatgggaagcagctgtgtacg
attcctcgcgatgctgcctactacagctatcagaacaggtatcatttctgtgagaagtgt
ttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcacagccccagacg
acaatttcaaaggatcagtttgaaaagaagaaaaacgataccttggatcctgaacctttt
gttgattgcaaggagtgtggccggaagatgcatcagatttgcgttctgcactatgacatc
atttggccctcaggcttcgtgtgtgacaactgcttgaagaaaagtggcagaccccgaaaa
gaaaacaaattcagtgctaagagactgcagaccacacggttgggaaaccacctggaagac
cgagtgaacaagtttttgcggcgccagaatcacccagaagctggggaggtttttgtcaga
gtggtggccagttcagacaagacggtggaggtcaagcctgggatgaagtcacgattcgtg
gattctggagaaatgtctgaatcgttcccataccgaaccaaagctctctttgcttttgag
gaaatcgacggcgtggatgtgtgcttctttggcatgcatgtccaggagtatggctccgac
tgcccccctcccaacacaaggcgtgtgtacatctcttacctggacagtattcatttcttc
cggccccgatgcctccggacagccgtttaccatgagatccttattgggtatctagagtat
gtgaagaaattggggtatgtgacagggcacatctgggcctgtcccccgagtgaaggagat
gactacatcttccattgccacccccctgatcaaaaaatcccaaaaccaaaacgactgcag
gagtggtacaagaagatgctggacaaggcatttgcagagcgcatcattcatgactacaag
gacattttcaaacaagcaacagaggacaggctcacaagtgccaaggaactaccgtatttc
gaaggtgatttctggcccaacgtgttggaagagagcattaaggaactggaacaagaggag
gaggagaggaagaaagaagaaagcaccgcagccagcgagaccaccgagggcagccagggt
gacagcaagaatgccaagaaaaagaacaacaagaaaaccaacaagaataagagcagcatc
agccgggcaaacaagaagaaacccagtgtgcccaatgtgtccaacgacctgtcccagaag
ctctacgccaccatggagaagcacaaggaggtcttcttcgtgatccacctgcacgccggg
cccgtcatcaacaccttgccccccattgtggaccccgacccactgctcagctgcgatctc
atggatgggcgcgacgccttcctcacccttgccagggacaagcactgggagttctcctcc
ttgcgccgttccaagtggtccacgctgtgcatgctggtggagctccacacccagggccag
gaccgctttgtctacacctgtaacgagtgcaagcaccatgtggagacgcgctggcactgt
accgtgtgcgaggactacgacctttgcatcaactgctacaacacaaagagccacacccac
aagatggtgaaatgggggctgggcctagatgacgagggcagtagccagggcgagccacag
tccaagagcccccaggagtctcggcgtctgagcatccagcgctgcatccagtccctggtg
cacgcctgccagtgccgcaacgccaactgctctctgccgtcctgccagaagatgaaacgg
gtagtgcagcacaccaagggctgcaagcgcaaaaccaacgggggctgcccagtgtgcaag
cagctcatcgccctgtgctgctaccatgccaagcactgccaagaaaacaaatgccccgtg
cccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcaccgcctgcag
acccagccccgcctgcagcaggcccagctcatgcgccgacgcatggccaccatgaacacc
cgcaatgtgcctcagcagagtctgccttctcctacctcagcaccacccgggacccccacg
cagcagcccagcacgccccagacgccgcagccccccgcccagccccagccctctcctgtg
agcatgtcaccagccggctttcccagcgtgactcggactcagcccccccctgcggcagtg
gaagcagcccggcagattgagcgcgaggcccagcagcagcagcacctataccgagtgaac
atcaacaacagcatgcccccagggcgcacgggcatgggggctccggggaaccagatggcc
cctgtgggcctgaacgtgccccgacccagccaggtcagcaacactgtcatgcccagcatg
ccgccgtgcagccggccaggagcatctcacccacagcagcagcaggtgctgaacacccac
aaatcaaacccgcagctaatggcggctttcatcaaacagcgcacggccaagtatgtggca
aatcagcctggcctgcagccccagcccggcctccagtcccaacccagcctgcagccccag
cctgccatgcaccagcagccaggcctgcagaacctgaacgctatgcaggctggggtgccg
cgacccggggtgcctccacagcagcagacgatgggaggcagctgctacagcagcagcagc
agcagcagcaacagcagcagccgcagccgccggaaaaaccaaggcgggggcatggcgggg
catggtcagttccagcagcctcaaggacctggaggctacccgccagccatgcagcagcag
cgaatgcagcagcacctccccatccagggcagctccatgggccagatggcggctcagatg
ggccagcttggccagatagggcagcccgggctgggggccgacggcacccccaacatccag
caggccctgcagcagcggattctgcagcagcagcagatgaagcagcagattgggtccccg
ggccagccgaaccccatgagcccccagcagcacatgctctcaggacagccgcaggcctcc
catctccccggccagcagatcgccacgtcccttagtaaccaggtgcgatctccagcccct
gtccagtctccgcggccccagtcccaacctccacattccagcccgtctccacggatacag
ccccagccctcgccacaccacgtgtcgccccagactggttccccccaccccggacttgca
gtctctatggccagctccatagaccagggacacttggggaaccccgaacagagcgcaatg
ctccctcagctcaacaccccgaataggagcgcactgtccagcgaactgtccctggtcggg
gacaccacaggagacacgctagagaagtttgtggagggtttgtag

DBGET integrated database retrieval system