KEGG   Tupaia chinensis (Chinese tree shrew): 102484959Help
Entry
102484959         CDS       T02978                                 

Gene name
ART3
Definition
ADP-ribosyltransferase 3
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102484959 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 421 aa AA seqDB search
MKTGHFEMVTVLLAAMILVDIFQVKADMLDMADNVFDDEYLKCTDRMESKYVPQLLKDEK
AGLQLLETVWENARAKWEARKTQLFLPVNFKDNHGIALIAYVSEAQEQTPFYHLFNEAVK
TAGQSRKDYIYGFQFKAFHFYLTRALQLLRRPCEDSYKNVVYGTSQDTSFTFGGLSQARL
GHFTLAYSARPQAVTDQDTVLAIHTCYGVSTENFSDKESERSILIPLSEIFQVSWDGSGS
NLMLQSTNKTCSHFECAFLGGLKTERCVENLENFQPVYVYNPGEKNQKLEDPGMKSHEPT
QIPGMKIPEPFSLPGIKLVQPDETPEDKSQGKINNPTYRAMFKNALQSCIASQWEYVLRN
ALGDFISKPRCSNSSSSSTSSSSSGSQNPSFRILWQDAPSTDWDARFNQCFCCKSLRCSV
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaggacattttgaaatggtcaccgtcctgctggcggccatgattctagtggac
atcttccaggtgaaggctgatatgttagacatggcagataatgtatttgatgatgaatac
ctgaaatgcactgacaggatggaaagcaaatacgttccccaactgctcaaggatgagaaa
gcaggccttcagctcttagagaccgtgtgggaaaatgcaagagccaaatgggaagctcgg
aagactcagctctttctcccggtgaatttcaaggataaccacgggattgccctgatagcg
tacgtttctgaagctcaggagcaaactccattttaccatctgttcaacgaagctgtgaaa
acggctggccaatcccggaaagattatatctacggcttccagtttaaagcttttcatttt
tacctgaccagagccctgcagttgctgagaagaccctgtgaggacagttacaaaaacgtg
gtgtacggaacaagccaggacacctcgtttacgttcggagggctaagccaagccaggctt
ggccattttaccttggcgtattcggccagacctcaggccgttactgaccaggacaccgtg
ttagccatccatacgtgctatggcgtttccactgaaaacttttctgataaagaaagtgaa
agaagtattttaatacccctgagtgagatttttcaggtgtcatgggacggttctggcagt
aaccttatgcttcaaagcacaaacaagacctgcagccatttcgagtgtgcatttttaggc
ggactgaaaactgaacgctgcgttgagaacctagaaaattttcaacctgtctatgtctac
aaccctggtgagaaaaaccagaagcttgaagaccctggtatgaaaagccatgagcccacc
cagatacctggaatgaaaattccagaacctttttcactacctggaataaaattggtacaa
ccggatgaaacacctgaagacaaaagtcaaggaaaaatcaacaatcctacttacagagct
atgtttaaaaatgcattacagtcctgcatcgcttcacaatgggaatatgtcctgagaaat
gcgttaggcgatttcatcagcaaacctagatgctccaattccagctccagctccacttcc
agttccagttccgggtcccaaaacccatccttccgcatcctctggcaagatgctccttcc
accgattgggacgctcgttttaatcagtgcttctgctgtaaatctcttcgttgctctgta
gtttga

DBGET integrated database retrieval system