KEGG   Tupaia chinensis (Chinese tree shrew): 102485260Help
Entry
102485260         CDS       T02978                                 

Gene name
JOSD2, Josephin-2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102485260 (JOSD2)
Peptidases [BR:tup01002]
 Cysteine Peptidases
  Family C86
   102485260 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 188 aa AA seqDB search
MSQAPGAQPGPPSVYHERQRLELCAVHALNNVLQRQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALREVGGIYYNLDSKLRAPEVLGNEDGVRAFLAAALAQGLCEVLLVVTKEVEE
KGCWLQAA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccgggagcacagcccggcccgccctccgtgtaccacgagcggcagcgc
ctggagctgtgcgccgtccacgccctcaacaacgtcctgcagcggcagctcttcagccag
gaggctgcggacgagatctgcaagaggctggccccagactcccggctgaacccccatcgc
agcctcctgggcaccggcaactatgatgtcaacgtgatcatggccgccctgcaggggctg
ggcctggcggccgtgtggtgggacaggaggaggcccctgtcccagctagccctgccacag
gtgctggggctgatcctgaacctgccctcgcctgtgtcactggggctgctgtccctgccg
ctgcgccggcggcactgggtggctctccgcgaggtgggcggcatctactacaacctggac
tccaagctgcgggcgcctgaggtcctggggaacgaggacggagtcagggccttcctggcg
gccgcgctggcccagggcctgtgtgaggtgctgctggtggtgaccaaggaggtggaggag
aagggctgctggctgcaggcagcctga

DBGET integrated database retrieval system