KEGG   Tupaia chinensis (Chinese tree shrew): 102485737Help
Entry
102485737         CDS       T02978                                 

Gene name
COMT
Definition
(RefSeq) catechol-O-methyltransferase
  KO
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102485737 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    102485737 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102485737 (COMT)
Enzymes [BR:tup01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102485737 (COMT)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102485737 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 266 aa AA seqDB search
MSAATPLLLAAVALGLVLLVLLFRSRYWIFVVFFWTEFILQPVLNLFMGSSKEQRILDHV
LQHATRGNPQSVLDTIDTYCWQKEWAMNVGDRKGQIVDSVVQECRPAVLLELGAYCGYSA
VRMGRLLPPGARLITIELNPTYATITQQMVEFAGLQDKVTVVVGASQDIIPQLKKKYDVD
TLDMVFLDHWKDRYLPDTQLLEECGLLRKGTVLLADNVIIPGTPEFLAYVRGNNRFECTH
YSSYLEYRSEVVDGLEKAVYVGPGQP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggccacgcccctgctgttagccgccgtcgctctgggcctcgtactgctggtg
ctgctcttccggagccgctactggatctttgtcgtcttcttctggaccgagttcatcctg
caacccgtcctaaacctgttcatgggcagctccaaggagcagcgcatcctggaccacgtg
ctgcagcacgccacgcgcgggaacccgcagagcgtgctggacaccatcgacacctactgc
tggcagaaggagtgggccatgaacgtgggcgacaggaaaggccagattgtggactccgtg
gtgcaggagtgccgccccgcggtgctgctggagctgggtgcctactgcggctactcggcc
gtgcgcatgggtcgcctgctgccgcccggggcccggctcatcaccatcgagctcaacccc
acctatgccaccatcacgcagcagatggtggagttcgccggcctgcaggacaaggtgacc
gtagtggtcggggcctcccaggacatcataccccagctgaagaagaagtatgacgtggac
acgctggacatggtcttcctcgaccactggaaggaccgctacctgcccgacacgcagctg
ctggaggagtgtggcctgttgcggaaggggacggtgctgttggcagacaacgtcatcatc
ccgggaacaccggaattcctggcgtacgtgcgcgggaacaaccgctttgagtgcacgcac
tactcttcctacctggagtaccggtcggaggtggtggacggcctggagaaggccgtctac
gtgggcccgggccagccatga

DBGET integrated database retrieval system