KEGG   Tupaia chinensis (Chinese tree shrew): 102491327Help
Entry
102491327         CDS       T02978                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102491327
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     102491327
Cytochrome P450 [BR:tup00199]
 Cytochrome P450, animal type
  CYP21 family
   102491327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 531 aa AA seqDB search
MDGQRFEVQTCQGQWDRCHAENVPLCGRDNRKRPEGRGQERPQNSPAGSVAGLESYKWPS
RGLCQVSAMLFFGLLLLALLAGAQLLRGWWGPRSLHLPPLAPGFLHLLQPNLPIHLLGLT
QTLGPVYRLRLRRPDVVVLNSKKTIEEAMVRKWVDFAGRPHLWSYKLVSEHHPDLSLGDY
SLLWKAHKRLTRSALALGMGSSMEPLVEQMTQEFCERMRAQAGAPVAIQKEFSFLTCSII
CYLTFGDKVKAALTAPRLCVQDVMKAWAHWSIQILDMVPFLRFVPNPVLRRLRQVVENRD
HIVERQLRQHKESLVAGQWRDMTDYMLQGVGQHRAEGPRQLHEGHVHMAVVDLFIGGTET
TATTLSWAVAFLLHHPEIQQQLQEELDLALGPCTSGSRVVYADRTRLPLLNATIAEVLRL
RPVVPLALPHHTTRRSSVCGYDIPKGTVIIPNLQGAHLDATVWDQPHEFRPDRFLEPGKS
PRAAFTLLPPPAGTLPSLQPQPYGGVNLTMQPFQVCLQPRGGEAPGLGQCQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggatgggcagcgttttgaagtgcagacttgccaaggtcaatgggaccgctgccatgct
gagaatgtccccctttgtgggcgggacaacaggaagagacctgaaggtaggggccaggag
aggccccaaaacagtccggcaggatcggtggcagggctcgagagctataagtggccgtcc
cggggcctttgccaggtttctgccatgctgttcttcgggttgctgctgctggccctgctg
gctggtgcccagctgctgaggggctggtgggggccccggagcctccacctgccccctctc
gccccgggcttcctgcacctgctgcagcccaacctccccatccacctgctcggcctgaca
cagacgctcgggcctgtctacaggctgcggctccggcggcccgacgtggtggtgctgaac
tccaagaagaccatcgaagaggccatggtcaggaagtgggtggactttgccggcaggccc
cacttatggtcctacaagctggtgtctgagcaccacccagacctgtccctaggggactac
tccctgctctggaaggcccacaagaggctcacccgctccgccctggcgctgggcatgggc
agctccatggagcccttggtggagcagatgacccaggagttctgcgagcgcatgagggcc
caggccggcgcccccgtggccatccagaaggagttctccttcctcacctgcagcatcatc
tgctacctcacgttcggagacaaggtcaaggctgccctcacagcccctcggctctgcgtc
caggacgtgatgaaagcctgggcccactggtccatccagattctggacatggttcccttt
cttaggttcgtgcccaacccggtgctccggaggctgaggcaggtcgtggagaacagggac
cacattgtggagaggcagctgagacagcacaaggagagcctggtggccggccagtggagg
gacatgacggactacatgctccaaggggtggggcagcacagagcggagggcccccggcag
ctccacgagggccacgtgcacatggctgtggtggacctcttcatcgggggcaccgagacc
acagcgaccacactgtcctgggccgtggctttcctgcttcaccaccctgagatccagcag
caactgcaggaggagttagacctggccctgggcccctgcacctccggctcccgggtggtg
tacgcggaccgcacgcggctgcccctgctcaacgccaccatcgccgaggtgctgcggctg
cggcccgtcgtgcccttggccttgccccaccacaccacgcggcgcagcagcgtctgtggc
tatgacatccccaagggcaccgtcatcatccccaacctccaaggcgcccacctggacgcg
acggtctgggatcagccccacgagttccggcctgatcgcttcctggagcctggcaagagc
ccccgagcggccttcacgctgctgccgccgcccgccggcaccctgccctccctgcagccc
cagccctacggcggcgtcaacctcaccatgcagcctttccaggtgtgcctgcaaccccgg
ggcggggaggccccgggcctgggccagtgccagtga

DBGET integrated database retrieval system