KEGG   Tupaia chinensis (Chinese tree shrew): 102491815Help
Entry
102491815         CDS       T02978                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102491815 (ALPL)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102491815 (ALPL)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102491815 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 582 aa AA seqDB search
MVKGVGRCGLINPALPLTCCVTSGLEHQLRSDHCQPTPSHPHRSCLWAPERKQVTGSTMI
SPLLVLALGTCLTTSLVPEKEKDPKYWRDQAQQTLKNALDLQKLNTNVAKNVILFLGDGM
GVSTVTAARILKGQLHHHPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVK
ANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSASYAHSA
DRDWYSDNEMPPEALSQGCKDIAYQLMHNVRDIEVIMGGGRKYMYPKNRTDVEYEMDEKS
RGTRLDGLNLIDVWKSFKPRHQHAHFVWNRTELLALDPYTVDYLLGLFEPGDMQYELNRN
NVTDPSLSEMVEVALTILKKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQA
GAMTSLEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPGYK
VVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYIPH
VMAYAACIGANLDHCAQGSTAGSPAPGPLLLLLALLPLSSLF
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaggagttggacgatgtgggctcataaacccagctctgccattgacctgctgt
gtgacctcaggattggaacatcagctaagatctgaccactgccaacccaccccctcacac
ccacatcggtcgtgtctctgggccccagagaggaagcaggtcacggggagcaccatgatt
tcgccactgttagtgctggcccttggcacctgccttaccacctccttagtgccagagaag
gagaaggaccccaaatactggcgagaccaagcccagcagactctgaagaatgccctggac
cttcagaagctcaacaccaacgtggctaagaacgtcatcctgtttctgggggatgggatg
ggcgtctccacggtgacggctgctcgcatcctcaagggccagctccaccaccacccgggg
gaggagacgaggctggagatggacaaattccctttcgtggccctgtccaagacatataac
accaacgcccaggtccccgacagcgcaggcactgccaccgcctacttgtgtggggtgaag
gccaacgagggcaccgtaggggtgagcgcggccaccgagcgctcccgctgcaacaccact
caaggcaacgaggtcacctccattctgcgctgggccaaggacgctgggaagtccgtgggc
atcgtgaccaccacgcgagtgaaccacgccacccccagtgcctcctacgcccactcagct
gaccgagactggtactcggacaacgagatgcccccagaggccctgagccagggctgcaag
gacattgcctaccagctcatgcacaacgtcagggacatcgaggtgatcatgggaggtggc
cggaagtacatgtaccccaagaataggaccgacgtggagtacgagatggatgagaagtcc
aggggcacgaggctggatgggctgaacctcattgacgtctggaagagcttcaaacctcga
caccagcacgcccacttcgtctggaaccgcaccgagctcctggcccttgacccctacacc
gtggactacctcttgggtctcttcgagccgggagacatgcagtacgagctgaacaggaac
aatgtgacagacccgtccctctccgagatggtggaggtggccctcacgattctgaagaag
aaccccaaaggcttctttttgctggtggaaggaggcaggatcgaccacggacaccacgaa
ggcaaagccaagcaggcactgcacgaggcggtggagatggaccgggcaatcggacaggca
ggtgccatgacctccctggaagacacgctgaccgtggtcactgctgaccactcccacgtc
ttcacctttggtggatacaccccccgtggcaactctatctttggcttggctcccatggtg
agcgacacggacaagaagcccttcaccgccatcctctatggaaacgggcctggctacaag
gtcgtgggcggtgagcgagaaaatgtctccatggtcgactacgctcacaacaactaccag
gcccagtcggccgtgcccctgcgccacgagacccacggcggggaggacgtggctgtcttc
gccaagggccccatggcgcacctgctgcacggcgtccatgagcagaactacatcccccac
gtgatggcctacgcggcctgcatcggggccaacctggaccactgtgcccagggcagcacg
gcgggcagccccgccccggggcccctgctgctcctgctggccctgctgcccctgagcagc
ctgttctga

DBGET integrated database retrieval system