KEGG   Tupaia chinensis (Chinese tree shrew): 102492328Help
Entry
102492328         CDS       T02978                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102492328 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102492328 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102492328 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102492328 (LPL)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102492328 (LPL)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102492328 (LPL)
  Exosomal proteins of breast milk
   102492328 (LPL)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102492328 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tup00537]
 Enzymes
  102492328 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 478 aa AA seqDB search
MASKALLLVALGVWLQSLAAFRGGVATADRVAGGRDFMDIESKFALRTPEDTAEDTCHLI
PGVAESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVVVVDWLSRA
QQHYPVSAGYTKLVGKDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEESPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRAQMPYKVFHYQVKIHFSGTESDKQ
TNQAFEISLYGTVAESENIPFTLPEVATNKTYSFLIYTEVDIGELLMLKLAWKSDSYFGW
SDWWSSPGFAIEKIRVKAGETQKKVIFCSREKVSRLQKGKAPAVFVKCHDKSLNKKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaaagctctgctcctggtggccctgggcgtgtggctccagagtctggccgcc
ttccgcggaggggtggccaccgccgaccgagttgcaggaggaagagatttcatggacatc
gaaagtaaatttgccctcaggacccctgaagacacagccgaagacacatgccatcttatt
cctggggttgcagagtctgtagctaactgccacttcaaccacagcagcaaaaccttcgtg
gtgatccatggctggacggtgaccgggatgtacgagagttgggtgccgaagctggtggcc
gccctgtacaagcgggagcctgactctaacgtggtggtggtggactggctgtcgcgggcc
cagcagcattacccagtgtctgccggctacaccaagctcgtggggaaggacgtggccagg
ttcatcaactggatggaggaggaatttaactacccactggataatgtccatctcttagga
tacagtcttggagcccacgctgctggtgtggcaggaagtctgaccaataagaaggtgaac
aggatcaccggcctcgatcctgccggacctaactttgagtatgcagaagccccaagtcgc
ctttctcccgatgatgcggattttgtggatgtcctgcacacgttcaccagagggtctccc
ggccgaagcatcgggatccagaaaccagtggggcatgttgacatttatcccaatggaggc
acttttcagccggggtgtaacattggggaggccatccgtgtgattgcagagagaggcctc
ggagatgtggaccagctggtgaaatgctcccacgaacgctccatccatctcttcatcgac
tccctgttgaacgaggaaagtccgagtaaagcctaccggtgcaactcgaaggaggccttc
gagaaagggctctgtctgagctgcaggaagaaccgctgcaacaacttgggctatgagatt
aataaggtccgagccaaacgcagcagcaagatgtacctgaagacccgcgctcagatgccc
tacaaagtcttccactaccaagtcaagattcacttttctgggactgagagtgataagcag
accaaccaggccttcgagatctctctgtatggcaccgtggctgagagcgagaacatcccc
ttcaccctgcctgaggttgccacgaataagacctactcgttcctgatctacacggaggtg
gacatcggggaacttctgatgctgaagctcgcgtggaagagtgactcctacttcggctgg
tcagactggtggagcagccccggctttgctattgagaagatcagagtaaaagcaggagag
actcagaaaaaggtgatcttctgttccagggagaaagtgtcccgtttgcagaaaggaaag
gcaccagcggtttttgtgaagtgccacgacaagtctctgaacaagaagtctggctga

DBGET integrated database retrieval system