KEGG   Tupaia chinensis (Chinese tree shrew): 102493586Help
Entry
102493586         CDS       T02978                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    102493586 (DHCR7)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     102493586 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 475 aa AA seqDB search
MAAKSQPNAPRTKNPTDISNGSTAPQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYGCSLTAPIVDLATGHVGLSDIWARTPPVTKEAAQLYVLWITFQVLLYISLPDFCHK
FLPGYVGGVQEGAVTPAGVVNKYEINGLQAWLITHLLWFVNSHFLFWFSPTIIFDNWIPL
LWCANILGYTVSTFAMIKGYFFPTKAEDCKFTGNFFYNYMMGIEFNPRIGEWFDFKLFFN
GRPGIVAWTLINLSFAAKQQELYGQVTNSMVLVNVLQAIYVLDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLLGYYIFRMTNHQKDL
FRRTDGRCLIWGRKPKVIECAYTSADGRKHHSKLLVSGFWGLARHFNYTGDLMGSLAYCL
ACGGGHLLPYFYIIYMAILLIHRCLRDEHRCALKYGRDWERYIAAVPYRLLPGIF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaatcccaacccaacgctcctagaaccaagaatcctactgacatctccaac
ggcagcactgcacctcaagggcaatggggccgtgcctgggaggtagactggttctccctc
gcaagcgtcatcttcctgctgctgttcgcgcccttcatcgtgtactacttcatcatggcg
tgtgaccagtatggctgctctctgactgcccccatagtggaccttgccacaggtcatgtt
ggactctcagacatctgggccaggaccccgcctgtgacgaaggaagcagcccagctctat
gtcttgtggatcacattccaggtgcttctgtacatatctcttcctgacttctgccataaa
tttctgccaggctatgtgggaggagtccaagagggggctgtgactcctgcaggagttgta
aacaagtatgaaatcaacggtctgcaagcctggctcatcacccatctcctttggtttgtc
aactcccacttcctgttctggttctctccaactatcatctttgacaactggattccgctg
ctgtggtgtgccaacatcctcggctacactgtgtccactttcgcaatgatcaagggctac
tttttccctaccaaggctgaagactgcaaattcacaggcaatttcttttacaactacatg
atgggcattgagtttaatccccgaattggggagtggtttgacttcaagctgtttttcaat
ggacgccctgggatcgtcgcctggaccctcatcaacctgtcctttgcagctaaacagcag
gaactctatggccaagtgacaaattccatggtcttggtcaacgtcctgcaggccatctac
gtgctggacttcttctggaatgaaacctggtatctgaaaaccatcgatatctgccatgac
cactttggctggtacttgggctggggtgactgcgtctggctgccgtacctttacacactg
cagggtctgtacttggtctaccatccagtgcagctctccaccccccacgcggtgggcgtc
ctgttgctaggcctgctgggctactacatcttccgcatgaccaaccatcagaaagacctg
ttccgccgcaccgatgggcgctgcctgatctggggcaggaagcccaaggtcatcgagtgt
gcgtacacgtccgccgacggtcggaagcaccatagcaagctgctggtgtcgggcttctgg
ggcctggcccgccacttcaactacacaggtgacctgatgggcagcctggcctactgcctg
gcctgcggcgggggccacctgttgccttacttctacatcatctacatggccatcctgttg
atccaccgctgcctccgggacgagcaccgctgcgccctcaagtacggcagagactgggag
cgctacatcgccgctgtgccttaccgcctgctgcccgggatcttctaa

DBGET integrated database retrieval system