KEGG   Tupaia chinensis (Chinese tree shrew): 102493683Help
Entry
102493683         CDS       T02978                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102493683 (ART4)
Cellular antigens [BR:tup04090]
 Proteins
  102493683 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 330 aa AA seqDB search
MKLHGQQRTLNTNAXLLTNRCKRILLPTTVLDYSAPTMRIWLLRRQLLLLLLLSGPQRPT
RSSEVAGKVNFDLAAGSFDDQYHGCGKQVMEELSRGDYFTKELKHHKNYSQIWHQAHLTW
LNRAKALPKDMTIPHVVAMLVYTLKSNVRADFIHAMASAARSPQQYEHAFHFKYLHYYLT
SAIQLLRKERVMKNDTLCYEVHHGMKDVSFKAYTGDTIRFGQFISASLLREEVQKFVNQT
LFTISTCLGAPVQDFSLKKEVLIPPYELFEVVNMRYHPSGNWLQLRSAGNLSTYNCQLLK
ASSKKCMPASTVIASVSFLTSIIISSKSQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcatgggcaacagagaactttgaacacaaacgctngtctattgactaataga
tgcaagaggattcttctcccgactactgtactggactactcggctccaacaatgagaatc
tggctcctcagaaggcagttgctgcttctgctgctgctctctggcccacagagacccacc
aggagttctgaggttgcaggtaaagtcaactttgacttggcagctggctccttcgatgat
cagtaccacggctgtggcaaacaggtcatggaggaactaagtcgaggagattatttcact
aaagaactaaaacaccataagaattactcccagatatggcaccaagcccatttgacctgg
ctgaaccgtgcaaaagctctccccaaggatatgactatcccacatgttgtggctatgttg
gtttacacgttgaagagtaatgttcgtgctgactttattcacgccatggccagtgctgcc
aggtctccacagcagtatgaacatgcattccatttcaaatatctacactactacctgacc
tcagcaatccagctgctgaggaaagagagagtcatgaagaatgacacactctgctatgag
gtgcatcatgggatgaaggatgtctccttcaaagcctacacaggagacaccattcggttt
ggccaattcatctctgcctctctcctaagagaagaggtacagaagtttgttaaccagaca
ctatttaccatatctacctgcctgggtgcacctgtgcaagacttctcccttaagaaggaa
gtcctgatccctccctatgagttgtttgaagtcgtgaatatgagatatcacccaagtgga
aactggttgcaactacggtcagctgggaacttgagtacatataactgccagctactaaag
gcatccagcaagaagtgcatgcctgcttctacagttattgcttctgtctcctttttgact
agtatcatcatctcttccaaaagccaagtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system