KEGG   Tupaia chinensis (Chinese tree shrew): 102495500Help
Entry
102495500         CDS       T02978                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102495500 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 309 aa AA seqDB search
MMLAALLSTLSYLGLHALWQAQAVPILPLGLAPDTFDDAYVGCSEEMEKKAASLLKEEMA
HHALLRESWEAAQEAWEHRRQGLTLPPSFKAQHGIAVMVYTNSSNTLYWELNQAVRTGGS
SRELYMRHFPFKALHFYLTRALQLLRGSGGCSRDLGEMVFRGMGSLRFEAKRLGDSVRLG
QFASSSLDEAVAHRFGNATLFSLRTCFGAPIEALSVFPKEREVLIPPHEVFLVTRFSQDG
ARSLVTLWSYNQTCSHFNCAYLGGEKRRSCVPGPAAGQPESPSAGASSLLSWKSLLLVPG
GFQISGAGP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggcggccctgctgagcaccctcagctacctgggcctccacgccctctggcag
gctcaggctgttcccatcctgcccctgggcctggctccagacacctttgatgatgcctat
gtgggctgctcagaggagatggagaagaaggcagcctccctgctgaaggaggagatggcc
caccatgctctgctgcgggagtcctgggaggcagcccaggaagcctgggagcacaggcga
caaggactcacgctgccccccagcttcaaagcccagcatggaatagctgttatggtctac
accaactcgtctaacaccttgtactgggagctgaaccaggccgtgcgcacaggaggcagc
tcccgggagctctacatgaggcacttccccttcaaggccctgcatttctacctgacccgg
gccctacagctgctgcggggcagtgggggctgcagcagggacctcggggagatggtgttt
cgaggcatgggcagtcttcgctttgaagccaagaggctgggcgactctgtccgcttgggc
caatttgcttccagctccctggatgaggcagtggcccacaggtttggtaatgccaccctc
ttctccctaagaacttgctttggggcccctatcgaggccctgtctgtcttccccaaggag
cgtgaggtgctgattcccccccatgaagtcttcttggtcaccaggttctcccaggatgga
gcccggagcttagtgactctctggagctataatcagacctgcagccacttcaactgcgcc
tatttgggtggtgagaagcggcggagctgtgtgccgggaccagcagcggggcagccagag
tctccctccgcaggggcctcctctctgctgtcctggaagagcctgctattggtccctggg
gggttccagatctcaggagctggaccctga

DBGET integrated database retrieval system