KEGG   Tupaia chinensis (Chinese tree shrew): 102496469Help
Entry
102496469         CDS       T02978                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:tup00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102496469 (NCOA3)
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102496469 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1402 aa AA seqDB search
MSGLGENSLDPLATDSRKRKLPCDTPGQGLSCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVSWTNETQRQKSHTFNCRMLMKIPHDLLEDMNSSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRHPVTND
RHGFVSTHFLQREQNGYRPNPNPVGPGVRPPAAGCSGSVGGMSVSPNPGLPMLSGRTYGL
ADSSPAGQMSGARYGGSSNIASMTPGPGIQSPSSYQNSSYGLNMSSPPHGSPGLGSNQQS
IMISPRNRGSPKMASHQFSPVTGVHSPMGSSGNPGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNIAQPSKMSSQDSKSPLGLYCDQNPVESSMCPSNSRDHLSDKESK
ESGAEGPETQRGPLEGKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCGEG
SIKQEQLSPKKKENNALLRYLLDRDDPSDTLAKELQPQVEGVDGKTGQCSSSAIPSSSQE
KDSKVKTETSEEGSGDLDNLDAILGDLTSSDFYNHSVSTNGSHLGTKQQLFQGANPLAGL
RSPQSVPSARPPYNRAVSLDSPVSVGSSPPVKNMSAFPMLPKQSMLGGNPRMMDSQENYS
SNMGGPNRNVTMNQTPPSGDWGLPNAKASRMEPMSSGPMGRPGGEYAAALPRPAMGASVP
TLPLRSNSIPGARPALQPQPQQQMLPMRPGEIPMGMGVNPYGQAAPSNQPGSWPDGLLSM
EQGPHGAQNRPLLRNSLDDLLGPPSNLEGQSDENALLDQLHTLLSNTDATGLEEIDRALG
IPELVNQGQALEPKQDAFPGQEAAVMMDQKAALYGQSYPAQGPPMQGGFNLQGQSPSFNS
MMTQMNQQGSFPLQGIHPRASVMRPRTNTPKQLRMQLQQRLQSQQFLNQSRQALEVKMES
PTAGGAAVMRPMMQPQVGPQQGFLNTQMVAQRSRELLSHHFRHQRAAMMMQQQQQTQAFS
PPPNVTASPSMDGVLAGPAMPPAPPQQFPYPPSYGVGQQPDPAFGRVSSPPNAMMSRMAP
SQNSMMQHPQTAPMYQSSEMKGWPSGNLTRNSSFSQPQFAHQGSPAAYSMVHVNGGGAHM
GPMNVNSMPMSGMPMGPDQKYC
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggttaggagaaaactccttggatcccctggccactgactcccgaaaacgtaaa
ttgccgtgtgacactccaggtcaaggtctcagctgcagtggtgaaaagtggagacgggag
caggagagtaaatacatcgaagaactggctgaactcatatctgctaatcttagtgatatt
gacaatttcaacgtcaaaccggataagtgtgcgattttgaaggaaacagtaagacagata
cgtcaaataaaagaacaaggaaaagctatttccaatgatgatgatgttcagaaagctgac
gtgtcttccacagggcagggagtgatcgacaaagactccttaggaccacttttacttcag
gcactggatggtttcctgtttgtggtgaatcgagatgggaacattgtgtttgtgtcagaa
aatgttacacaatacctgcagtataagcaggaagacctggttaacacaagtgtctacaat
atcttgcatgaagaagacagaaaagattttcttaaaaatttaccgaaatcaacagttaat
ggagtttcttggacaaacgagactcagagacaaaaaagccatacgttcaattgccgtatg
ttgatgaaaataccacatgatcttctggaagacatgaatagcagtcccgaaatgcgccag
agatacgaaacgatgcagtgctttgccctgtctcagccacgtgctatgatggaggaaggg
gaagatttgcaatcctgtatgatctgtgtggcacgtcgcatcactacaggagaaagagca
tttccatcaaaccccgagagctttatcactagacatgacctttcaggaaaggttgtcaat
atagatacaaattcactgagatcgtccatgaggcctggcttcgaagatataatccgaagg
tgtattcagagattttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccacgctgagacgccggtgtatcgattctcattggccgac
ggaaccatagtgaccgcacaaacaaagagcaaactcttccgacatcccgtaacgaatgat
cgccatggctttgtttcaacccactttcttcagagagaacagaatgggtatcgaccaaac
ccaaatcctgtcggaccaggcgtcaggccccccgcggctggatgcagcggatcagtgggc
ggcatgagcgtgtcgccaaacccaggcttacccatgctgagcggcaggacctatggcttg
gctgactccagccctgcaggtcagatgagcggagcgaggtatggaggttccagtaacata
gcctccatgactccggggccaggcattcagtcaccatcctcctaccagaacagtagctac
gggctcaacatgagtagccccccgcacgggagtcctggtcttggctccaaccagcagagt
atcatgatttctcctcgtaatcgcgggagtccaaagatggcctcacatcagttttctcct
gttacaggggtgcactctcccatgggctcgtctggcaatcccgggagccacagcttctcc
agcagctctctcagtgccctgcaagccatcagcgagggcgtggggacttcgctgttatct
accttgtcttccccaggtcctaaattggataactcccccaatatgaatatagcccaacca
agtaaaatgagtagtcaggattctaagagtcccctaggcttgtactgcgaccagaatcca
gtggagagttccatgtgtccgtcaaatagcagagatcacctcagcgacaaggagagtaag
gagagcggtgcggaaggcccagagactcagagagggcccttggaaggcaagggccataaa
aagctcctgcagttactcacctgttcctctgatgaccgagggcattcctccctgaccaac
tcccccctggattccagttgtaaagactcatccattagtgtcaccagcccctccggagtc
tcctcctcgacatctggaggcgtgtcctctacgtccaacatgcacgggtccctgctgcag
gagaagcaccggattttgcacaagttgctgcagaacgggaactcaccggctgaggtagcc
aagatcaccgccgaggccaccgggaaagacaccagcagcacagcttcttgtggggagggg
agcatcaagcaggagcagctgagccctaagaagaaggagaacaacgcactccttcggtac
ctgctggacagggacgatcccagcgacacactggccaaagagctgcagccgcaggtggaa
ggggtggatggtaagacaggccagtgcagcagctccgccatccccagctccagtcaagag
aaggactctaaagtgaagacagagaccagcgaggaggggtctggagacttagataattta
gatgctattcttggtgacctgaccagttctgacttttacaatcattccgtatccacaaat
ggcagtcacctggggaccaagcaacagctgttccaaggagcaaatcctttggcaggtctg
aggagcccgcagtctgtgccatccgctcgtcccccctacaaccgagcagtgtctctagat
agccctgtttctgttggctctagtcctccagtgaagaacatgagtgctttccccatgtta
ccaaagcaatccatgctgggcggcaatccaaggatgatggatagtcaggaaaattatagc
tcaaatatgggtggaccaaacagaaacgtgactatgaatcagactcctccctcaggagac
tggggcttaccgaacgcaaaggccagcagaatggaacccatgagttcgggccccatgggg
agaccgggaggagagtatgctgctgcgttacccagacccgcgatgggcgcctccgtgccc
acgctgccgcttcggtctaacagcatcccaggggcaagaccagcactgcagccacagccg
cagcagcagatgcttccgatgaggcctggtgagattcccatgggaatgggagtcaatccc
tatggccaggcagcaccatccaaccagccagggtcctggccagatggccttttgtccatg
gaacaaggccctcacggggctcaaaacaggcccctccttaggaattccttggatgatctc
cttgggccaccctctaacttggaagggcagagcgatgaaaatgcattgttggaccagctg
catactctcttgagcaacacagatgctacgggcctggaagaaattgacagagctttgggc
atccctgaacttgtaaatcagggacaagctttggagcccaagcaggatgctttcccaggc
caagaagcagcagtaatgatggatcagaaggcagctttgtatggacagtcctacccggca
caggggcctccaatgcaaggaggctttaatcttcagggacaatcaccatcttttaattct
atgatgactcagatgaaccagcaaggcagttttcccctccaaggaatacacccgcgggcc
agcgtcatgagaccccggacaaacacccccaagcagctgaggatgcagctccagcagagg
ctgcagagccagcagtttttgaatcagagccggcaggcacttgaggtgaaaatggagagc
cccacggctgggggtgcggcagtcatgaggcccatgatgcagccccaggtgggccctcag
cagggcttccttaacacccagatggtcgcccagcgcagcagagagctgctgagtcaccac
ttccggcaccagcgggctgcgatgatgatgcagcagcagcagcagacccaggccttcagc
ccaccgcctaacgtgaccgcgtctcccagcatggatggggtgttggcgggacccgcgatg
ccacccgctccaccacagcagtttccataccctccaagttacggagtgggacagcagcca
gatccagcctttggtcgagtgtctagccctcctaatgcaatgatgtcgagaatggctccc
tcccagaattccatgatgcagcaccctcagaccgcacccatgtatcagtcctcagaaatg
aagggctggccatcaggaaacttgacccggaatagctccttctcgcagccgcagttcgcc
caccagggaagccccgcagcgtacagcatggtgcacgtgaacggtggcggtgcgcacatg
ggaccgatgaacgtgaactccatgcccatgtctggcatgcccatgggtcccgatcagaaa
tactgctga

DBGET integrated database retrieval system