KEGG   Tupaia chinensis (Chinese tree shrew): 102496469Help
Entry
102496469         CDS       T02978                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102496469 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102496469 (NCOA3)
   05224 Breast cancer
    102496469 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    102496469 (NCOA3)
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102496469 (NCOA3)
Chromosome [BR:tup03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102496469 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1402 aa AA seqDB search
MSGLGENSLDPLATDSRKRKLPCDTPGQGLSCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVSWTNETQRQKSHTFNCRMLMKIPHDLLEDMNSSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRHPVTND
RHGFVSTHFLQREQNGYRPNPNPVGPGVRPPAAGCSGSVGGMSVSPNPGLPMLSGRTYGL
ADSSPAGQMSGARYGGSSNIASMTPGPGIQSPSSYQNSSYGLNMSSPPHGSPGLGSNQQS
IMISPRNRGSPKMASHQFSPVTGVHSPMGSSGNPGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNIAQPSKMSSQDSKSPLGLYCDQNPVESSMCPSNSRDHLSDKESK
ESGAEGPETQRGPLEGKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCGEG
SIKQEQLSPKKKENNALLRYLLDRDDPSDTLAKELQPQVEGVDGKTGQCSSSAIPSSSQE
KDSKVKTETSEEGSGDLDNLDAILGDLTSSDFYNHSVSTNGSHLGTKQQLFQGANPLAGL
RSPQSVPSARPPYNRAVSLDSPVSVGSSPPVKNMSAFPMLPKQSMLGGNPRMMDSQENYS
SNMGGPNRNVTMNQTPPSGDWGLPNAKASRMEPMSSGPMGRPGGEYAAALPRPAMGASVP
TLPLRSNSIPGARPALQPQPQQQMLPMRPGEIPMGMGVNPYGQAAPSNQPGSWPDGLLSM
EQGPHGAQNRPLLRNSLDDLLGPPSNLEGQSDENALLDQLHTLLSNTDATGLEEIDRALG
IPELVNQGQALEPKQDAFPGQEAAVMMDQKAALYGQSYPAQGPPMQGGFNLQGQSPSFNS
MMTQMNQQGSFPLQGIHPRASVMRPRTNTPKQLRMQLQQRLQSQQFLNQSRQALEVKMES
PTAGGAAVMRPMMQPQVGPQQGFLNTQMVAQRSRELLSHHFRHQRAAMMMQQQQQTQAFS
PPPNVTASPSMDGVLAGPAMPPAPPQQFPYPPSYGVGQQPDPAFGRVSSPPNAMMSRMAP
SQNSMMQHPQTAPMYQSSEMKGWPSGNLTRNSSFSQPQFAHQGSPAAYSMVHVNGGGAHM
GPMNVNSMPMSGMPMGPDQKYC
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggttaggagaaaactccttggatcccctggccactgactcccgaaaacgtaaa
ttgccgtgtgacactccaggtcaaggtctcagctgcagtggtgaaaagtggagacgggag
caggagagtaaatacatcgaagaactggctgaactcatatctgctaatcttagtgatatt
gacaatttcaacgtcaaaccggataagtgtgcgattttgaaggaaacagtaagacagata
cgtcaaataaaagaacaaggaaaagctatttccaatgatgatgatgttcagaaagctgac
gtgtcttccacagggcagggagtgatcgacaaagactccttaggaccacttttacttcag
gcactggatggtttcctgtttgtggtgaatcgagatgggaacattgtgtttgtgtcagaa
aatgttacacaatacctgcagtataagcaggaagacctggttaacacaagtgtctacaat
atcttgcatgaagaagacagaaaagattttcttaaaaatttaccgaaatcaacagttaat
ggagtttcttggacaaacgagactcagagacaaaaaagccatacgttcaattgccgtatg
ttgatgaaaataccacatgatcttctggaagacatgaatagcagtcccgaaatgcgccag
agatacgaaacgatgcagtgctttgccctgtctcagccacgtgctatgatggaggaaggg
gaagatttgcaatcctgtatgatctgtgtggcacgtcgcatcactacaggagaaagagca
tttccatcaaaccccgagagctttatcactagacatgacctttcaggaaaggttgtcaat
atagatacaaattcactgagatcgtccatgaggcctggcttcgaagatataatccgaagg
tgtattcagagattttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccacgctgagacgccggtgtatcgattctcattggccgac
ggaaccatagtgaccgcacaaacaaagagcaaactcttccgacatcccgtaacgaatgat
cgccatggctttgtttcaacccactttcttcagagagaacagaatgggtatcgaccaaac
ccaaatcctgtcggaccaggcgtcaggccccccgcggctggatgcagcggatcagtgggc
ggcatgagcgtgtcgccaaacccaggcttacccatgctgagcggcaggacctatggcttg
gctgactccagccctgcaggtcagatgagcggagcgaggtatggaggttccagtaacata
gcctccatgactccggggccaggcattcagtcaccatcctcctaccagaacagtagctac
gggctcaacatgagtagccccccgcacgggagtcctggtcttggctccaaccagcagagt
atcatgatttctcctcgtaatcgcgggagtccaaagatggcctcacatcagttttctcct
gttacaggggtgcactctcccatgggctcgtctggcaatcccgggagccacagcttctcc
agcagctctctcagtgccctgcaagccatcagcgagggcgtggggacttcgctgttatct
accttgtcttccccaggtcctaaattggataactcccccaatatgaatatagcccaacca
agtaaaatgagtagtcaggattctaagagtcccctaggcttgtactgcgaccagaatcca
gtggagagttccatgtgtccgtcaaatagcagagatcacctcagcgacaaggagagtaag
gagagcggtgcggaaggcccagagactcagagagggcccttggaaggcaagggccataaa
aagctcctgcagttactcacctgttcctctgatgaccgagggcattcctccctgaccaac
tcccccctggattccagttgtaaagactcatccattagtgtcaccagcccctccggagtc
tcctcctcgacatctggaggcgtgtcctctacgtccaacatgcacgggtccctgctgcag
gagaagcaccggattttgcacaagttgctgcagaacgggaactcaccggctgaggtagcc
aagatcaccgccgaggccaccgggaaagacaccagcagcacagcttcttgtggggagggg
agcatcaagcaggagcagctgagccctaagaagaaggagaacaacgcactccttcggtac
ctgctggacagggacgatcccagcgacacactggccaaagagctgcagccgcaggtggaa
ggggtggatggtaagacaggccagtgcagcagctccgccatccccagctccagtcaagag
aaggactctaaagtgaagacagagaccagcgaggaggggtctggagacttagataattta
gatgctattcttggtgacctgaccagttctgacttttacaatcattccgtatccacaaat
ggcagtcacctggggaccaagcaacagctgttccaaggagcaaatcctttggcaggtctg
aggagcccgcagtctgtgccatccgctcgtcccccctacaaccgagcagtgtctctagat
agccctgtttctgttggctctagtcctccagtgaagaacatgagtgctttccccatgtta
ccaaagcaatccatgctgggcggcaatccaaggatgatggatagtcaggaaaattatagc
tcaaatatgggtggaccaaacagaaacgtgactatgaatcagactcctccctcaggagac
tggggcttaccgaacgcaaaggccagcagaatggaacccatgagttcgggccccatgggg
agaccgggaggagagtatgctgctgcgttacccagacccgcgatgggcgcctccgtgccc
acgctgccgcttcggtctaacagcatcccaggggcaagaccagcactgcagccacagccg
cagcagcagatgcttccgatgaggcctggtgagattcccatgggaatgggagtcaatccc
tatggccaggcagcaccatccaaccagccagggtcctggccagatggccttttgtccatg
gaacaaggccctcacggggctcaaaacaggcccctccttaggaattccttggatgatctc
cttgggccaccctctaacttggaagggcagagcgatgaaaatgcattgttggaccagctg
catactctcttgagcaacacagatgctacgggcctggaagaaattgacagagctttgggc
atccctgaacttgtaaatcagggacaagctttggagcccaagcaggatgctttcccaggc
caagaagcagcagtaatgatggatcagaaggcagctttgtatggacagtcctacccggca
caggggcctccaatgcaaggaggctttaatcttcagggacaatcaccatcttttaattct
atgatgactcagatgaaccagcaaggcagttttcccctccaaggaatacacccgcgggcc
agcgtcatgagaccccggacaaacacccccaagcagctgaggatgcagctccagcagagg
ctgcagagccagcagtttttgaatcagagccggcaggcacttgaggtgaaaatggagagc
cccacggctgggggtgcggcagtcatgaggcccatgatgcagccccaggtgggccctcag
cagggcttccttaacacccagatggtcgcccagcgcagcagagagctgctgagtcaccac
ttccggcaccagcgggctgcgatgatgatgcagcagcagcagcagacccaggccttcagc
ccaccgcctaacgtgaccgcgtctcccagcatggatggggtgttggcgggacccgcgatg
ccacccgctccaccacagcagtttccataccctccaagttacggagtgggacagcagcca
gatccagcctttggtcgagtgtctagccctcctaatgcaatgatgtcgagaatggctccc
tcccagaattccatgatgcagcaccctcagaccgcacccatgtatcagtcctcagaaatg
aagggctggccatcaggaaacttgacccggaatagctccttctcgcagccgcagttcgcc
caccagggaagccccgcagcgtacagcatggtgcacgtgaacggtggcggtgcgcacatg
ggaccgatgaacgtgaactccatgcccatgtctggcatgcccatgggtcccgatcagaaa
tactgctga

DBGET integrated database retrieval system