KEGG   Tupaia chinensis (Chinese tree shrew): 102497535Help
Entry
102497535         CDS       T02978                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102497535 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102497535 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102497535 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    102497535 (PTGS1)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102497535 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 602 aa AA seqDB search
MSRRRLSLRFLLFLLLLLLLPPGILPGGPEADAPLNPCCYYPCQHQGVCVRFGLDRYQCD
CTRTGYSGPNCTVPELWTWLRNSLRPSPSFFHFLLTHGRWFWEFVNASFIRDMLMRLVLT
VRSNLIPSPPTYNSAHDYISWEAFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLG
QRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDSL
ERQYQLRLFKDGKLKYQVLDGEIFPPSVEEAPVLMHYPRGIPRQSQMAVGQEVFGLLPGL
MLYATLWLREHNRVCDLLKAEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQ
LKFDPELLFRVQFQYRNRIAMEFNQLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYG
VEALVDAFSRQIAGRIGGGRNMDHHVLHVAVETIKESRELRLQPFNEYRKRFGMKPYTSF
QELTGEKEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEIGAPFSLKGLLGNP
ICSPEYWKPSTFGGKVGFNIVNTATLKKLVCLNTKTCPYVSFRVPESNENTEPAVERPST
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagccggaggagactgtcgctccgatttctgctgttcttgctgctgctgctgctgctg
ccgcccggaattctgccggggggccccgaggcggatgcgcctttgaacccatgctgttac
tatccctgccagcaccagggtgtctgtgtccgcttcggccttgaccgctaccagtgtgac
tgcacccgcacgggctattccggccccaactgcaccgtcccggagctgtggacctggctc
cggaattccctgcggcccagcccctctttcttccacttcctgctcacacacgggcgctgg
ttctgggagttcgtcaatgccagcttcatcagagacatgctcatgcgcctggtcctcaca
gtacgctccaacctcatccccagtccccccacctacaactcagcacacgactacatcagc
tgggaggccttctccaacgtgagctactacactcggattctgccctccgtgcccaaagac
tgccccacgcccatgggaaccaaagggaagaagcagttgccagatgcccagctgctgggc
caacgcttcctgctcaggaggaagttcatacccgacccccagggcaccaacctcatgttt
gccttctttgcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcct
ggcttcaccaaggccttgggccatggcgtagaccttggccacatttatggagacagtctg
gaacgtcagtatcagctgcgactctttaaggatgggaaactcaagtatcaggtgctggat
ggagagatattcccaccatcagttgaagaggcacctgtattgatgcactatccacggggc
atcccacgccagagccagatggctgtgggccaggaggtgtttgggctacttcctgggctc
atgctctatgccacactctggctgcgcgagcacaaccgcgtgtgtgacctgctgaaggct
gagcaccccacctgggatgacgagcagctcttccagacgacccgcctcatcctcataggg
gagaccatcaagattgtaatcgaggagtatgtgcagcagctgagtggctacttcttacag
ctgaagttcgaccctgagctgctcttcagggtccaattccaataccgcaaccgcattgcc
atggagttcaatcagctctaccactggcacccgctcatgcccgactccttcaaggtgggc
tcccaagagtacagctacgagcagttcttgttcaacacctccatgcttgtggactatggg
gtcgaggccctggtggatgccttttctcgccagattgctggccggattggtgggggtagg
aacatggaccaccatgtcctgcatgtggctgtggagaccatcaaggagtctcgagagttg
cgactgcagcctttcaatgaataccgtaagaggtttggcatgaagccctacacctccttc
caggaactcacaggagagaaagagatggcagctgagttggaggagttatatggagacatc
gatgccttggagttctacccagggttgcttctcgaaaagtgccaaccaaactctatcttt
ggggagagtatgatcgagattggtgctcccttttctcttaagggtcttctaggaaatccc
atctgttctccggagtactggaagccaagcacatttggtggcaaggttggcttcaacatt
gtcaatacagccacactgaagaagctggtctgcctcaacaccaagacctgtccctacgtt
tccttccgagtacctgaatccaatgagaacactgagcctgctgtagagcggccatccaca
gagctctga

DBGET integrated database retrieval system