KEGG   Tupaia chinensis (Chinese tree shrew): 102497774Help
Entry
102497774         CDS       T02978                                 

Gene name
UCHL5
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase L5
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102497774 (UCHL5)
Peptidases [BR:tup01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102497774 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 405 aa AA seqDB search
MQLLRSNTYTPEDFNLNTAVSCKSLPTLSYESPDPGRRLSAQKPRERRRKRRSNQALGTP
ACREPCEGPCSAETRGPGEGGPTAGAGWIETVSEKLRASQNGCRGAQVEEIWSLEPENFE
KLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQD
VHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTSAKEEDAFH
FVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIV
SDRKMIYEQKIAELQRQLAEEEPMDTDQGNNMLSAIQSEVAKNQMLIEEEVQKLKRYKIE
NIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttttgaggagtaatacatatacgcctgaagacttcaatcttaacactgcagta
tcctgtaagagcctgccgactctttcttatgaatccccggatccggggcgacgcctctcc
gcgcagaagccgcgggagaggcggaggaagaggaggagtaaccaggccctggggacgccg
gcctgccgggagccgtgcgaggggccctgctcggccgagacccgcgggccgggcgagggc
ggccccacagcgggtgcaggttggattgaaacggtgtcagagaagctacgagcctctcaa
aatggttgccgaggagcccaggtagaagaaatatggagtttagaacctgagaattttgaa
aaattaaagccagttcatggattaatttttcttttcaagtggcagccaggagaagaacca
gcaggctctgtggttcaggactccagacttgacacgatattttttgcaaagcaggtaatt
aataatgcttgtgctactcaagccatagtgagtgtgttattgaactgtacccatcaggat
gtccacttgggagaaacattatcagagtttaaagaattttcacaaagttttgatgcagct
atgaaaggtttggcactgagcaactcggatgtgattcgacaagtgcacaatagttttgcc
agacagcaaatgtttgaatttgatgcaaagacatcagcaaaagaagaagatgcttttcac
ttcgtcagttatgttcctgttaatggaagactgtacgagttagacggattaagagaagga
ccgattgatttaggtgcatgcaatcaagatgattggatcagtgcagtgaggccagtcata
gaaaaaaggatacagaagtatagtgaaggcgaaattcgatttaacttaatggccattgtg
tctgacagaaaaatgatatatgaacagaagatagcagagttacaaagacaactcgcagag
gaggaacccatggatacagatcaaggtaataatatgttaagtgctattcagtcagaagtt
gccaaaaaccagatgcttattgaagaagaagtacagaaattaaaaagatacaagattgaa
aatatcagaaggaagcataattacctgcctttcattatggaattgttaaagactttagca
gaacaccagcagttgataccactggtggaaaaagcaaaagaaaaacagaacgcaaagaaa
gctcaggaaaccaaatga

DBGET integrated database retrieval system