KEGG   Tupaia chinensis (Chinese tree shrew): 102498644Help
Entry
102498644         CDS       T02978                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102498644 (BAP1)
Peptidases [BR:tup01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102498644 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 729 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQDSQLPEESKPASSKSPLVLDASR
APASSEGTHTDGAEEVAGSCPQAPNHSPPSKPKLVVKPPGSSLNGVPPNPTPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEEDEEDEVQNTSSAIRYKR
KGTGKPGPLSSSADGQLSVLQPNTINVLTEKLKESQKDLSIPLSIKTSSGAGSPAVAVPT
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTESGKGSSPPIRPSQGNQGSSSPEE
KEVVEGSDSRERTGLGRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagcgacccgggcctcttcaccctcctggtggaa
gatttcggtgtcaaaggggtgcaggtggaagagatctatgaccttcagagcaaatgccag
ggccctgtatacggattcatcttcctgttcaaatggatcgaggaacgccggtcccgtcgc
aaggtctctaccttggtggatgatacgtcggtgattgatgacgatatcgtgaataatatg
ttctttgcccaccagctgatccccaactcttgtgccactcatgccttgctgagcgtgctc
ctgaactgcagcaacgtggacctggggcccaccctgagtcgcatgaaggacttcaccaag
ggtttcagccccgagagcaaaggatatgcaattggcaatgccccggagttggccaaggca
cataatagccatgccaggccagagccacgccacctccctgagaagcagaacggccttagt
gcagtgcggaccatggaagcattccactttgtcagctatgtgcctatcacaggccggctt
ttcgagctggatgggctgaaggtctaccccattgaccatgggccctggggagaggatgaa
gagtggacagacaaggcccggcgggtcatcatggagcgcatcggtctcgccactgcaggg
gagccctaccacgacatccgcttcaacctgatggcagtggtgcccgaccgcaggatcaag
tacgaggccagactgcacgtgctgaaggtgaaccgtcagacggtactggaggccctccag
cagctgattagggtcacccagccagagctgattcagacccacaagtctcaagactcacag
ctaccagaggagtccaagccagccagcagcaagtcccccttggtgctggacgcaagcagg
gccccagcaagctctgagggcacccacacagatggtgcagaggaggtggctggttcgtgc
ccacaagccccaaaccacagtcctcccagcaaacccaagctggtggtgaagcctccgggg
agcagcctcaatggggttccccccaaccccacccccattgtccagcggctgccagccttt
ctagacaatcacaactatgccaagtcccccatgcaggaggaggaggacctggcagcaggt
gtgggccgcagccgcgtcccagtgcgcccacctcagcagtactccgatgacgaggacgac
tacgaggaggacgaggaggacgaagtgcagaacaccagctctgccatcagatacaagcgg
aaagggacagggaagccagggccattgagcagttctgcggacgggcagctgtcagtgctg
cagcccaacaccatcaatgtcttgactgagaagctcaaagaatcccagaaggacctctcg
atccctctgtccatcaagactagcagtggggcagggagcccagctgtggcagtgcccaca
cactcgcagccctcacccacccccagcaacgagagcacggacacagcctctgagattggc
agcgctttcaactcaccactgcgctcacccatccgctcggccaacccaacgcggccctcc
agccctgtcacctcccacatctctaaggtgctttttggggaggatgacagcctgctgcgc
gttgactgcatacgctacaaccgcgctgtccgcgacctgggtcctgtcatcagcacgggc
ctgctgcacctcgctgaggacggggtgctcagtcccctggcgctgacagagagtgggaaa
ggttcctcaccccccatcagaccaagtcaaggcaaccaggggtctagcagcccagaggaa
aaggaggtggtggaaggctcggacagcagggagaggacagggctgggcaggcccggcgag
cccttgagtggggagaagtactcgcccaaggagctgctggcccttctcaagtgtgtggag
gccgagattgccaactacgaggcttgcctcaaggaggaggtcgagaagaggaagaaattc
aagattgacgaccagaggaggacccacaactacgacgagttcatctgcacctttatctcc
atgctggctcaggaaggcatgctggccaacctggtggagcagaacatctcagtgcggcgg
cgccaaggggtcagcatcggccgcctccacaaacagcggaagcctgaccggcggaaacgc
tctcgcccctacaaggccaagcgccagtga

DBGET integrated database retrieval system