KEGG   Tupaia chinensis (Chinese tree shrew): 102499911Help
Entry
102499911         CDS       T02978                                 

Gene name
ALDH1L1
Definition
(RefSeq) aldehyde dehydrogenase 1 family, member L1
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102499911 (ALDH1L1)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     102499911 (ALDH1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 897 aa AA seqDB search
MKIAVIGQSLFGQEVYCQLRKEGHEIVGVFTIPDKDGKADPLGLEAEKDGVPVFKFPRWR
ARGQALPDVVAKYQALGAELNVLPFCSQFIPMEVIDAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTVFWADDGLDTGDILLQKECEVLPDDTVSSLYSRFLFPEGVKGMVQAV
KLIAAGRAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWAEAGGQ
KLTFFNSTLNTSGLVPEGEALPIPGARRPGVVTKAGLILFGNDDRMLLVRNIQLEDGKTV
PASRFFTGPAGGALELTEEELLTAEAVRSMWRRVLPNHTTDFFKSGAASADVVRLVEEVK
ELCAGLELGGEDVYAATTFGDFVQLLVRRLRGEDEDGQCAIDYVERDVNKRTLRMPHQLF
IGGAFVDAEGGKTCDTINPTDGSVICQVSQAQVSDVDKAVAAAKEAFESGQWGKISARDR
GRLLYRLADLMELHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTI
PINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLT
ALKFAELTLKAGIPKGVINILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCALS
NVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEAAIHDQFVQ
RVVEEVRKMKIGNPLDRDTNHGPQNHQAHLAKLLEYCQRGVREGARLVCGGKQVPRPGFF
FEPTVFTDVEDHMSIAKEESFGPIMIVSRFADGDVDTVLSRANATEFGLASGVFTRDISK
ALYVSDRLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcagtgatcgggcagagcctgtttggccaggaggtttactgccagctgagg
aaggagggccatgagatcgtgggtgtgtttaccatcccagacaaggacgggaaggcagac
cccctgggcctggaggctgagaaggacggagtgccggtgttcaagttcccacgctggcgg
gcgcgaggacaggccctgcccgacgtggtggccaagtaccaggccctgggcgctgagctc
aacgtcctgcccttctgcagccagttcatccccatggaggtgatcgacgcgccccgccac
ggctccatcatctaccacccgtctctgctccccaggcaccggggtgcctcggccatcaac
tggaccctcattcatggggacaagaaaggggggttcactgtcttctgggcagacgatggc
ctggacaccggggacatcctgctgcagaaggagtgcgaggtgctccccgacgacaccgtg
agctctttgtacagccgcttcctcttccccgaaggcgtcaaagggatggtgcaggctgtg
aagctgatcgctgcgggcagagcccccaggctcccccagcccgaggaaggagccacctat
gaggggattcagaagaaggaaacagccaagatcaactgggaccagccagccgaggccatc
cacaactggatccgcggcaacgacaaggtgccaggcgcctgggccgaggccggcgggcag
aagctgacctttttcaactcgacattgaacacttcggggctggtgcccgagggggaagct
ctgcccatcccgggagcccgtcggccaggcgtggtcaccaaagcgggactcatcctcttc
gggaacgacgacaggatgctgctggtgaggaacatccagctagaggacggcaagacggtc
ccagcctcgcgcttcttcacggggccggcaggcggggccctggagctgaccgaggaggag
ctgctgaccgccgaggccgtgcggagtatgtggcggcgggtactccccaaccacaccact
gacttcttcaagtctggcgctgcatcggcggacgtcgtgaggctggtggaggaggtgaag
gagctgtgtgccgggctggagctggggggcgaggacgtgtatgcggccaccaccttcggg
gacttcgtccagctgctagtgcggaggctgcgtggggaggatgaagacggccagtgtgcc
atcgactatgtggaacgggacgtgaacaagcggacgctccgaatgccgcaccagctcttc
atcgggggggcctttgtggatgccgagggcggcaagacctgcgacaccatcaacccgaca
gacggaagtgtcatctgccaggtttcgcaggcccaggtcagtgacgtggacaaggcggtg
gctgcggcgaaggaagccttcgagagcggacagtggggcaagatcagcgcccgggaccgg
ggccggctcctgtacaggctggcggacctcatggagctgcaccaggaggagttggccacc
atcgaggccctggatgcaggagccgtctacacactggccctgaagacccacgtgggcatg
tccatccagaccttccgctactttgctggctggtgtgacaaaatccagggctccaccatc
cccatcaaccaggccagacccaaccgcaacctgaccctcaccaggaaggagcctgttggg
gtctgtggcatcatcatcccttggaactaccccctgatgatgctgtcctggaagacggcc
gcctgcctggccgccgggaacacggtggtgatcaagcccgcgcaggtgacgccactcaca
gccttgaagtttgcagagctgaccttgaaggctggtattcccaagggtgtgatcaacatc
ctcccaggatctggctcgctggttggccagaggctttcggaccaccccgacgtcaggaag
atcgggttcacgggctccacggaggtggggaagcacatcatgaagagttgcgccctgagt
aacgtgaagaaggtgtccctggagctgggtgggaagtcgcccctcatcatctttgctgac
tgcgacctcaacaaagctgtgcagatggggatgagctccgtgttcttcaacaaaggcgag
aactgcattgcggcgggccggctgttcgtggaggccgccatccatgaccagtttgtgcag
agggtggtggaggaggtgaggaagatgaagatcggcaaccccctggacagggacaccaac
cacgggccgcagaaccaccaggcccacctggcgaagctgctggagtactgccagcgtggc
gtgcgggagggggccaggctggtctgtggcgggaagcaagtccctcggccaggcttcttc
tttgagccgaccgtgttcacggacgtggaggaccacatgagcatcgccaaggaggagtcc
ttcgggcccatcatgatcgtgtcgcggtttgcggacggggacgtggacacggtgctctct
cgggccaatgccacggaatttggcctggcctccggtgtcttcacgagggacatcagcaag
gccctgtatgtgagcgacaggctggaggcgggcaccgtgttcgtcaacacgtacaacaag
acggatgtggccgctcccttcggagggttcaagcagtccggatttggcaaagacctggga
gaggctgctctgaacgaatacctgcgggtcaagacggtgacgttcgagtactga

DBGET integrated database retrieval system