KEGG   Tupaia chinensis (Chinese tree shrew): 102500267Help
Entry
102500267         CDS       T02978                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102500267 (PPOX)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102500267 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 483 aa AA seqDB search
MGRTVVVLGGGISGLAACYHLSRAPRPPKVVLVEGSPRLGGWIRSVQGPDGAIFELGPRG
IRPAGALGARTLLMVSELGLDSEVLPVRGNHPAALNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTQPRGKEPDETVHSFAERRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGQSPQPDSALIRQARAERWSQWSLRGGLEMLPQAL
DTHLTNRGVNILRGQPVCRLSLQAEGRWKVSLGDSSLEADHIISAIPASALSELLPAEAA
PLAGVLRTISAVSVAVVNLQYRGARLPVQGFGHLVPSAEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLAAGGALSQELFQQQAQEAAATQLGLKEPPSHCLVHLHKNCIPQ
YTVGHWQKLEAAKQFLAAQRLPLTLAGASYEGVAVNDCIESGRQAAFSVLGTEPHPDPHT
LQP
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaccgtggtcgtgctgggtggaggcatcagcggcttggctgcctgctaccac
ctgagccgggccccccgcccccctaaggtggtcctggtggagggcagcccgcgtctggga
ggctggatccgctcagtccaagggccggatggtgccatctttgaactcggccctcggggc
attcggccggcgggagccctgggagcccggaccctgctcatggtttccgagcttggcttg
gactcggaagtgttgcctgtccgagggaaccacccagcggccctgaacagattcctgtac
gtaggcggcgccctgcacgccctccccaccggcctcagggggctgcttcgcccgtcgcct
cccttttccaaacctctgttttgggcagggctgagggagctgacccagccccggggaaaa
gagcctgatgagactgtgcacagttttgccgagcgccgccttggacctgaggtggcgtct
ctagccatggacagtctctgccgaggagtgtttgcaggcaacagccgggagctcagcatc
aggtcctgctttcccagtctcttccaagctgagcaaacccaccgttcgatattactgggg
ctgctgctgggggcaggacagagcccacagccagactcagcactcattcgccaggcccgg
gctgagcgctggagccagtggtcactgcgtggagggctggagatgttgcctcaggctctt
gacacccacctgactaatagaggagtcaatattctgagaggccagcctgtgtgccggctt
agcctccaggcagaagggcgctggaaggtgtctctaggggacagcagtctggaggctgac
catattattagtgccattccagcttcagcactcagtgagctgctccccgcagaggccgca
ccgctggctggcgtgctgaggaccatctctgccgtgtcagtagctgtggtgaacctgcag
taccgaggagcccggctgcctgtccagggatttggccatttggtgccatccgcagaagac
ccaggtgtcctgggaatcgtgtacgactcagttgctttccctgagcaggacgggagtccc
cctggcctcagagtgactgtgatgctgggaggttcctggttacagacactggcagccggt
ggggccttgtctcaggaactgttccaacagcaagcacaggaagcagctgccacacagtta
ggactgaaggagcccccaagtcactgcctggtccatctccacaagaactgcattccccag
tacacagtaggccactggcaaaaactggaggcagctaagcaattcctggctgctcagagg
ttgcccctgacactggccggggcgtcctacgagggggttgctgtcaacgactgcatagag
agtgggcgccaggcggccttcagtgtcctgggcactgagccccaccccgacccccacacc
ctacaaccgtga

DBGET integrated database retrieval system