KEGG   Tupaia chinensis (Chinese tree shrew): 102501668Help
Entry
102501668         CDS       T02978                                 

Gene name
KAT7
Definition
K(lysine) acetyltransferase 7
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102501668 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGXXXXXLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcggagagtgacggcacatcccgacggtctgcc
cgagtcacgcgctcctcagccaggctcagccagagttctcaagattccagccctgttcga
aatttgcagtcttttggcactgaggagcctgcttattctaccagaagagtgacccgtagt
cagcagcagcctactccagtgactccaaaaaaatacccacttcggcagactcgttcgtct
ggctcagaaaccgagcaagtggttgatttttcagatagagaaactaaaaatacagctgat
catgacgagtcaccacctcgaactccaactggaaatgcaccttcttctgagtctgacata
gacatctccagccccaatgtttctcacgatgagagcattgccaaggacatgtccctgaag
gactcgggcagtgatctctctcatcgccccaagcgccgtcgcttccacgaaagctacaat
ttcaatatgaagtgtcctacaccaggctgcaactctctaggacaccttacaggaaaacac
gagagacatttctccatctcaggatgcccgctctatcataacctctcggctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtcccacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcaccaacagagaggcagctgcggtat
aaggaaaaggtggctgaactcaggaagaaaagaaattctggactaagcaaagaacagaaa
gagaaatacatggaacacagacagacctacggnnnnnnnnnnnnnnngctcttggaaaac
ctgactagcgagtacgacttggatcttttccgaagagcacaagctcgggcttcagaggat
ctggagaagttaagactacaaggccagatcaccgaagggagcaacatgattaaaacaatt
gcttttggccgctatgagcttgatacttggtaccattctccctatcctgaagaatatgca
cggctgggacgtctctacatgtgtgaattctgtttaaaatatatgaagagccaaacaata
cttcgccgacacatggccaagtgtgtgtggaaacacccacctggtgatgagatatatcgc
aaaggctcaatctctgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgctggccaagctttttttggaccacaagacgttgtattatgacgtggaaccc
ttcctgttttatgttatgacagaagcggacaacactggctgtcacttgattggctatttt
tccaaggaaaagaattcattcctcaactataacgtgtcctgtatccttaccatgcctcag
tacatgaggcagggctatggcaagatgctcatcgacttcagttatttgctttccaaagtg
gaagaaaaagttggttccccagaacgtccactctcagacctgggactcataagctatcgc
agttactggaaagaagttcttcttcgctacctgcataactttcaaggcaaagagatttct
atcaaagaaattagccaggagactgctgtgaatcctgtggacatcgtcagcactctgcaa
gcccttcagatgctcaagtattggaaaggaaagcacctagttttaaaaagacaggacctg
attgatgaatggatagccaaagaggccaaaaggtccaactccaataaaaccatggatcca
agctgcttaaaatggacccctcctaagggcacttaa

DBGET integrated database retrieval system