KEGG   Tupaia chinensis (Chinese tree shrew): 102502163Help
Entry
102502163         CDS       T02978                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  Jak-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease (NAFLD)
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04960  Aldosterone-regulated sodium reabsorption
tup04973  Carbohydrate digestion and absorption
tup05100  Bacterial invasion of epithelial cells
tup05142  Chagas disease (American trypanosomiasis)
tup05146  Amoebiasis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  HTLV-I infection
tup05167  Kaposi's sarcoma-associated herpesvirus infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05418  Fluid shear stress and atherosclerosis
Module
tup_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102502163 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    102502163 (PIK3CB)
   04015 Rap1 signaling pathway
    102502163 (PIK3CB)
   04012 ErbB signaling pathway
    102502163 (PIK3CB)
   04370 VEGF signaling pathway
    102502163 (PIK3CB)
   04630 Jak-STAT signaling pathway
    102502163 (PIK3CB)
   04668 TNF signaling pathway
    102502163 (PIK3CB)
   04066 HIF-1 signaling pathway
    102502163 (PIK3CB)
   04068 FoxO signaling pathway
    102502163 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102502163 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102502163 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102502163 (PIK3CB)
   04024 cAMP signaling pathway
    102502163 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102502163 (PIK3CB)
   04152 AMPK signaling pathway
    102502163 (PIK3CB)
   04150 mTOR signaling pathway
    102502163 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102502163 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    102502163 (PIK3CB)
   04218 Cellular senescence
    102502163 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102502163 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102502163 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102502163 (PIK3CB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102502163 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102502163 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102502163 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102502163 (PIK3CB)
   04660 T cell receptor signaling pathway
    102502163 (PIK3CB)
   04662 B cell receptor signaling pathway
    102502163 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102502163 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102502163 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102502163 (PIK3CB)
   04062 Chemokine signaling pathway
    102502163 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    102502163 (PIK3CB)
   04923 Regulation of lipolysis in adipocyte
    102502163 (PIK3CB)
   04915 Estrogen signaling pathway
    102502163 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102502163 (PIK3CB)
   04917 Prolactin signaling pathway
    102502163 (PIK3CB)
   04926 Relaxin signaling pathway
    102502163 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102502163 (PIK3CB)
  Digestive system
   04973 Carbohydrate digestion and absorption
    102502163 (PIK3CB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102502163 (PIK3CB)
  Nervous system
   04725 Cholinergic synapse
    102502163 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102502163 (PIK3CB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102502163 (PIK3CB)
  Development
   04360 Axon guidance
    102502163 (PIK3CB)
   04380 Osteoclast differentiation
    102502163 (PIK3CB)
  Aging
   04211 Longevity regulating pathway - mammal
    102502163 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102502163 (PIK3CB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102502163 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102502163 (PIK3CB)
   05231 Choline metabolism in cancer
    102502163 (PIK3CB)
   05205 Proteoglycans in cancer
    102502163 (PIK3CB)
   05203 Viral carcinogenesis
    102502163 (PIK3CB)
   05210 Colorectal cancer
    102502163 (PIK3CB)
   05212 Pancreatic cancer
    102502163 (PIK3CB)
   05225 Hepatocellular carcinoma
    102502163 (PIK3CB)
   05226 Gastric cancer
    102502163 (PIK3CB)
   05214 Glioma
    102502163 (PIK3CB)
   05221 Acute myeloid leukemia
    102502163 (PIK3CB)
   05220 Chronic myeloid leukemia
    102502163 (PIK3CB)
   05218 Melanoma
    102502163 (PIK3CB)
   05211 Renal cell carcinoma
    102502163 (PIK3CB)
   05215 Prostate cancer
    102502163 (PIK3CB)
   05213 Endometrial cancer
    102502163 (PIK3CB)
   05224 Breast cancer
    102502163 (PIK3CB)
   05222 Small cell lung cancer
    102502163 (PIK3CB)
   05223 Non-small cell lung cancer
    102502163 (PIK3CB)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102502163 (PIK3CB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102502163 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102502163 (PIK3CB)
   04931 Insulin resistance
    102502163 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102502163 (PIK3CB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    102502163 (PIK3CB)
   05166 HTLV-I infection
    102502163 (PIK3CB)
   05162 Measles
    102502163 (PIK3CB)
   05164 Influenza A
    102502163 (PIK3CB)
   05161 Hepatitis B
    102502163 (PIK3CB)
   05160 Hepatitis C
    102502163 (PIK3CB)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102502163 (PIK3CB)
   05169 Epstein-Barr virus infection
    102502163 (PIK3CB)
   05165 Human papillomavirus infection
    102502163 (PIK3CB)
   05146 Amoebiasis
    102502163 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    102502163 (PIK3CB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    102502163 (PIK3CB)
   01524 Platinum drug resistance
    102502163 (PIK3CB)
   01522 Endocrine resistance
    102502163 (PIK3CB)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102502163 (PIK3CB)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102502163 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 102502163
NCBI-ProteinID: XP_006158240
Position
Un
AA seq 1064 aa AA seqDB search
MPPAMADVLDIWAVDSQIASDGSIPVDFLLPTGIYIQMEVPREATISYIKQMLWKQVHNY
PMFNLLMEVDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGEKLDSKI
GVLIGKGLHEFDALKDPEVNEFRRKMRKFSEEKIQSLVGLSWMDWLKQTYPPEHEPSVLE
NLEDKLYGGKLIVAVHFENSQDVFSFQVSPNMSPIKVNELAIQKRLTIHGKEDEASPCDY
VLQVSGRVEYVFGDHPLIQFQYVRNCVMSRTLPHFILVECCKIKKMYEQEMLAIEGAIQR
SSSTPPLPLPPKKTRIISHIWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCK
TIVSSEISGKNDHVWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQ
TIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTNPYTE
NATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKEILDRDP
LSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREA
LELLDFNYPDQYVREYAVECLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALA
NRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLI
KLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPL
WLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGD
RSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCA
GYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIH
VIQQGKTGNTEKFGRFRQCCEDAYLVLRRHGNLFITLFALMLTAGLPELTSVKDIQYLKD
SLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctgctatggcggacgtccttgacatctgggccgtggactcgcagatcgcgtcc
gatggctccatccccgtggatttcctcttgcccactgggatctacattcagatggaggtg
cctcgggaagcgaccatttcttacattaagcagatgttatggaagcaagttcacaattac
cccatgtttaacctccttatggaagtggactcctacatgttcgcgtgtgtgaaccagacc
gccgtgtatgaggagctcgaagatgaaacacggagactctgcgacgtcaggcctttcctg
ccggtcctcaaattagtgacaagaagctgcgacccaggggaaaaactagattcaaaaatc
ggagttctcataggaaaaggtctgcatgaatttgatgccttgaaggatccagaagtgaat
gaatttcgaaggaaaatgcgcaaattcagcgaggaaaagattcagtcgctggttggattg
tcttggatggactggctgaagcagacatacccacccgagcatgagccgtctgtccttgaa
aacttagaagataaactttatggagggaagctcatcgtggctgttcattttgaaaatagt
caggatgtgtttagctttcaagtatctcctaacatgagccctatcaaagtaaatgagctc
gcgatccagaaacgcttgactattcacgggaaggaggacgaggcgagcccctgtgactat
gtgctgcaggtcagtgggagagtggagtacgtgttcggcgatcacccgctgatccagttc
cagtacgtccggaactgcgtaatgagcaggacgctgccccatttcattcttgtggagtgc
tgtaagattaagaagatgtacgagcaggagatgttggccatagaaggtgccatacagcgg
agctcgtccacccctcctctccccttgccgccaaagaaaacgcgaattatttctcacatc
tgggagaataacaaccctttccaaatcgttctggttaagggcaataaactgaacacagaa
gaaactgtaaaggttcatgtcagagctggtctttttcacggtactgagctcttgtgtaaa
accatcgtgagctcagagatatcaggaaagaacgaccacgtttggaacgagccgctggag
ttcgatattaacatatgtgacttgccgaggatggcacggttatgtttcgctgtttacgcg
gttttggataaagtgaagacgaagaaatcaactaaaactattaatccctctaaataccag
accatcaggaaagctggaaaagtgcattatcccgtagcgtgggtgaacaccatggttttc
gacttcaaaggacagctgagatctggagacgtaatactgcatagctggtcttcatttcct
gatgaacttgaagaaatgttgaatccaatgggaaccgttcaaacaaatccatatactgaa
aacgcaacagctttgcatatcaagtttccagagaataaaaaacagccttattactatcct
ccctttgataagattattgagaaggcagctgagatcgcaagcagtgatagtgctaatgta
tcaagtcggggtggaaaaaagtttcttgctgtcctgaaggagatcttggacagggacccc
ctgtctcagctgtgtgagaatgagatggatcttatctggactctgcgacaggactgcaga
gagaacttcccacagtcactgcccaagctgctgctgtcgatcaagtggaataagcttgag
gacgttgctcagctccaagcactgcttcagatttggcccaaactgcccccgcgggaggcc
ctggagcttctggacttcaactacccagaccagtacgtgcgggaatatgccgtggagtgc
ctgcaacagatgagtgatgaagaactctcgcagtaccttttacaactggtgcaagtgtta
aaatacgagcctttccttgattgtgccctgtctagattcctgctagaaagggcacttgct
aatcggaggataggacagtttctgttttggcatcttaggtccgaagtgcacattcccgcc
gtctcagtgcagttcggcgtcatcctggaagcttattgccggggaagcgtaggtcacatg
aaagtgctttccaaacaggttgaagcactcaataaattaaaaactttaaatagtttaatc
aaactgaatgcaatgaagctaaacagagccaaagggaaggaagccatgcacacctgttta
aaacagaatgcttaccgggaagctctctctgacctgcagtcacccctgaacccgtgtgtt
atcctctcagagctctatgttgaaaaatgcaaatacatggattctaaaatgaagcctttg
tggctggtgtataacaacaaagtatttggtgaggactcagttggagttatttttaaaaat
ggtgatgatttacgacaggatatgctgaccctccagatgctgcgactgatggatttactc
tggaaggaagcgggactggatcttcggatgctgccctacggctgcctcgccacaggagac
cgctccggcctcatcgaagtcgtgagcacctccgagaccatcgctgacattcagctgaac
agcagcaatgtggccgccgccgccgccttcaacaaggacgcccttctcaactggctgaaa
gagtacaactctggggatgacctggaccgagccattgaagaatttaccctgtcttgtgct
ggctactgtgtagcttcttacgtccttgggattggtgacagacatagtgacaatattatg
gtcaaaaaaactggccagctcttccacattgattttggacatattctcggaaatttcaaa
tctaaatttggtattaaaagggagcgagtgccttttatccttacctatgacttcattcat
gtcattcaacaaggaaaaacggggaacacggaaaagtttggccggttccgccagtgctgt
gaggacgcgtacctggtcttgcgccgccacgggaacctcttcattaccctgttcgccctg
atgctgaccgccggcctgcccgagctcacgtccgtcaaggatattcagtatcttaaggat
tctcttgccttagggaagagtgaagaagaagcactcaaacaatttaagcaaaagttcgac
gaggcgctcagggaaagctggacgactaaggtgaactggatggcccacacggtgcggaaa
gactacagatcctaa

DBGET integrated database retrieval system