KEGG   Tupaia chinensis (Chinese tree shrew): 102502341Help
Entry
102502341         CDS       T02978                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    102502341
Enzymes [BR:tup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102502341
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102502341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 148 aa AA seqDB search
MKALLVLGLLLLSVTVQGKKYESCELARTMKKHGMHNFKGISLATWMCVAKWESGYNTKA
INNNRKDQSTDYGIFQINSRYWCNDGKTPKAVNACRVSCNDMMKDDISQAIACAKRVVSD
PAGIQAWRAWSKHCQNQDVNQYIKGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctgcttgttctggggcttctgctcctttccgtcactgtccagggcaagaag
tatgaaagctgcgagttggcccgaactatgaaaaaacacggaatgcataacttcaaggga
attagcctggcaacctggatgtgtgtggccaagtgggagagtggttataacacaaaagct
ataaacaacaatcgtaaagaccaaagcactgactatggaatattccagatcaacagccgc
tactggtgtaacgatggcaaaactcccaaagcagttaatgcctgtcgtgtatcctgcaat
gatatgatgaaagatgacatctctcaagccatagcttgtgcaaagagggttgtcagtgac
ccagcaggcattcaagcatggagggcatggagtaaacactgtcagaaccaagatgtcaat
cagtacattaagggctgtggagtgtag

DBGET integrated database retrieval system