KEGG   Tupaia chinensis (Chinese tree shrew): 102502596Help
Entry
102502596         CDS       T02978                                 

Gene name
TGM7
Definition
transglutaminase 7
Orthology
K05623  
transglutaminase 7 [EC:2.3.2.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102502596 (TGM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 684 aa AA seqDB search
MGRKRLITRRGQAFTFQMFFSRPFQSQTDHIIFMAETGPEPTELLGTRATFLLTQAQXXX
XXXXVSEFTAASNSLQVTLFTPANAVIGYYTLKIEIIQGQGPSATYPVGTFILLFNPWST
EDDVYLPSEILLQEYIMKDYGFVYKGHEKFITSWPWNFGQFEEDIIDICFEILNKSLYFL
NNWSKDYSRRNDVVYVCRVVSAMINSNDDNGVLQGNWGEDYSRGVSPLEWNGSVAILRQW
SASGGQPVKYGQCWVFASVMCTVMRCLGVPTRVVSNFRSAHNVDGNLTIDTYYHRDAEML
PTQKRDKIWNFHVWNECWMIRRDLPPGYNGWQVLDPTPQQTSSGLFCCGPASVKAIREGE
VHLAYDTPFVFAEVNADEVIWLFEEGQAQEILAHNTSSIGKEISTKMVGSDQRQDITSSY
KYPEGSPEERSVFMKASRKMLDPKRSSSSFLDLLGSGSTEDRPAQLQLHLTKVPEWGQDL
LLMLHVRRVPDRVHPRGPIRLAVHFCAQALLHGGSAREPLWRQTVHLSLDFGEETRWPLL
LPYNSYRNRLTDEKLIRVSGIARVEETGKYMLVLKDISLEPPHLSIEVSERAEVGKALRV
HITLTNTLMVALSNCKMVLEGSGLISGQITHDLGTLVAEHTIQIHLDLYPVKAGPRQLQV
LISCNEIKEIKGYKDILVAAPRAS
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcacacgccgtggccaggccttcactttccaaatgttcttc
agccgacccttccagtcccagacagaccacatcatcttcatggctgagactggacctgag
cccacagagcttctggggacccgagccacattcttactcacccaggcccagnnnnnnnnn
nnnnnnnnnngtgtgtctgaattcacagctgcctccaactccctgcaagtcactctcttc
acaccagccaatgcagtcattggctactacactctgaagatagagatcatccagggccag
ggtcccagtgcaacttacccagtggggactttcatcctgctttttaacccttggagcaca
gaggatgacgtctacctgccgagtgaaatactgctgcaggagtatatcatgaaggactat
ggctttgtttacaagggtcatgaaaaattcatcacctcctggccctggaacttcggacag
tttgaagaggacatcatagacatttgctttgagattctgaacaagagcctgtacttccta
aacaactggtccaaagactactcccggcggaacgacgtggtgtacgtgtgcagggtggtg
agcgccatgatcaacagcaacgacgacaacggcgtgctgcaggggaactggggggaggac
tactccaggggggtcagcccgctggagtggaacggcagtgtggccatcctgcggcagtgg
tcggccagcggcgggcagcctgtgaagtacggacagtgctgggtctttgcatctgttatg
tgcaccgtaatgagatgcttaggtgttccaacccgtgttgtctccaatttccgttctgca
cacaatgtggacgggaacttgaccatcgacacctactatcaccgagacgcagagatgctg
ccaactcagaaacgagacaaaatctggaacttccatgtctggaatgaatgctggatgatc
cggagagacctcccacctggatacaatggatggcaggttctggaccccactccccagcag
accagcagtgggttgttctgctgtggccctgcttctgtgaaagccatcagggaaggggaa
gttcacctggcctacgacaccccttttgtgtttgccgaggtgaatgccgatgaagtcatt
tggctcttcgaggagggccaggcccaggaaatcctggcccacaacaccagttccattggg
aaggagataagcaccaagatggtagggtcagaccagcgccaagacatcaccagctcctac
aagtatcccgaagggtcccctgaggagcggtccgtgttcatgaaggcatcccggaaaatg
ttggaccctaaaaggtcctcttcttccttcttggatctactgggatccgggagcacagag
gaccggccagcacagctgcagctgcacctgaccaaggtgcctgaatggggccaggacctg
ctgctgatgctgcatgtccggagggtgccagacagagtccaccctcgggggcccatcagg
ctcgcagtgcacttctgtgcacaggccctgctgcacgggggcagcgcccgggagcccctc
tggaggcagacggtgcacttgagcctggactttggagaggagactcggtggccactcctg
ctgccctacaacagttacaggaacaggctgacagacgaaaagctgatccgtgtgtctggc
atcgcgagggtcgaagagacaggaaagtacatgctggtcctgaaagacatctctctggag
cctccccatttatctattgaggtgtctgagagggctgaggtgggcaaggcactgagggtc
cacatcaccctcaccaataccttaatggtggctctgagtaactgcaagatggtgctggag
ggcagcggcctcatcagtggccagatcacacatgacctggggactctggtggctgaacac
accatccagattcatctggacctctaccctgtcaaagctggaccccgccagctgcaagtc
ctcatcagctgcaatgagatcaaggagatcaaaggctacaaggacatcctcgtggcagca
ccgagagcttcctga

DBGET integrated database retrieval system