KEGG   Tupaia chinensis (Chinese tree shrew): 102503060Help
Entry
102503060         CDS       T02978                                 

Gene name
CKMT1A, CKMT1B
Definition
(RefSeq) creatine kinase, mitochondrial 1A
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00330  Arginine and proline metabolism
tup01100  Metabolic pathways
Module
tup_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102503060 (CKMT1A)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102503060 (CKMT1A)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102503060 (CKMT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 102503060
NCBI-ProteinID: XP_006162918
Position
Un
AA seq 414 aa AA seqDB search
MAGSFSRLLSARPGLRLLALAGAGSLAAGRPEPVRAASERRRLYPPSAEYPDLRKHNNCM
ASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFD
PVIQERHNGYDPRTMKHTTDLDANKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAE
RREVERVVVDALSGLKGDLAGRYYRLSDMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARD
WPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWE
FMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAAT
GNVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPAPLAHSKH
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggctggttccttctcccgtctgctgtccgcccgtccggggctcaggctcctggctttg
gccggagctgggtctctagcggctgggcgcccggaacctgtacgagccgccagtgaacga
cggaggctgtatcccccaagcgctgagtacccagacctccgaaagcacaacaactgcatg
gccagtcacctgaccccagcagtctatgctcggctctgcgacaagaccacacccactggt
tggacgctagatcagtgtatccagactggcgtggacaaccctggccaccccttcatcaag
actgtgggcatggtggctggagatgaggagacctatgaggtatttgctgacctgtttgat
cctgtgatccaagaaagacacaatggatatgaccccaggacaatgaagcataccactgac
ctggatgccaataagatccgttctggctattttgatgagaggtatgtattgtcctcaaga
gtcagaactggccgaagtatccggggactcagtctgcctccagcctgcactcgggcagag
cgacgagaggtggaacgtgtggtggtggatgctttgagtggcctgaagggtgacctggcc
ggacgttactataggctcagtgacatgacagaagctgagcagcagcagcttattgatgac
cattttctatttgataagcctgtgtccccattgctgactgcagctgggatggctcgagac
tggccagatgctcgtggaatctggcacaacaatgagaagagcttcttgatctgggtgaat
gaggaagatcatacccgggtcatctccatggagaagggtggcaacatgaagagagtgttt
gaaagattctgccgaggcctcaaagaggtggagcggctcatccaggagcgtggctgggaa
ttcatgtggaatgaacgtttgggatacatcttgacctgtccatctaatctaggcactgga
cttcgggcaggagtgcacatcaaacttcccctgctaagcaaagatagccgcttcccaaaa
atcctggagaacctaagactccaaaagcgtggtactggaggagtggacactgctgccaca
ggcaacgtctttgacatctctaatttggaccgactgggcaaatcggaggtggagttggtg
caactggtcatcgatggagtaaattatttgatcgactgtgaacggcgtctggagagaggc
caggatatccgcatccctgcacctcttgctcacagcaagcattaa

DBGET integrated database retrieval system