KEGG   Tetranychus urticae (two-spotted spider mite): 107365243Help
Entry
107365243         CDS       T04901                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
Enzymes [BR:tut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107365243
Peptidases [BR:tut01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107365243
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107365243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 385 aa AA seqDB search
MLRQRKIQSDYTSQPSPSSLSSPKLMMDTKYSKKPTRRINFLYILLSLFGVFIFIAYVAV
PVAFKLSPTIRRHLLFMNYVNFQVNMNLSNPENEYKLKCTKVFHVDSSDGASLGVWHILP
GSLVNKYCPTGFGKDLKDVDESRLFDDDRPIVLYSHGNGGTRGGNHRLGLYRLLAYGELD
AHVITFDYRGFGDSTNMHPSVPGLVDDAFHMYKWLSSKVNHTRINIWGHSLGTAVSVALS
KRIGSDDKPNTLTLEAPFNAVADAIREYPLAAIYKIYPLFDFFFIQPFDLPEYRLFDSQT
NIKDVKFPILIMHAKDDAIVPFKLGHKLYESALQGYSGKSDQAKPVMIIYEEEHGYGHKN
IYKDSLLTKIIIKFFSHQEIGQTTF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgccaaaggaaaattcagtctgattacacgtctcaaccaagtccatcatcatta
tcatcacccaaactgatgatggacactaaatactcaaaaaaacctactagacggataaac
ttcctttacatcctattatctctgtttggtgttttcatctttattgcctatgttgcagtg
cctgttgctttcaagttaagtccgacgattcgtcgtcatctgctttttatgaactatgtt
aatttccaggtgaatatgaatttgagtaatccagaaaatgagtacaaactcaagtgtacc
aaagtgttccatgttgactcttccgatggtgcctcattaggtgtttggcatattttgcct
ggcagtttagtcaacaaatactgtccaacaggctttggtaaagacttgaaagatgtcgat
gaatcacggttatttgatgatgacagaccgattgtgctctactctcatggtaatggagga
actcgtggaggaaaccaccgtcttggactttatcgattattagcttatggagagctggat
gctcatgtgattacatttgattacagaggattcggggattcaactaacatgcatccatca
gttccagggttagtggatgatgcttttcatatgtacaaatggctttcaagcaaagtgaat
catacccgtatcaatatttggggccattcacttggaacagcagtttcagtagcattgtct
aaaagaatcggctctgatgataaaccaaacacattaactctggaagcaccttttaatgcc
gtagctgatgccattcgtgaatacccgttagcagccatttacaaaatttatccgttgttt
gatttcttctttattcaaccttttgatttacctgaatatcgtttatttgatagtcaaaca
aacataaaagatgttaaatttccaattttaatcatgcatgcaaaagatgatgctatagta
cccttcaaactaggccataagctatatgaaagcgctttacaaggatacagtgggaaatct
gatcaagccaaaccagttatgatcatttacgaagaggaacatggctatggtcacaagaat
atttacaaggattcgttgttgaccaaaatcatcatcaagtttttctctcatcaagaaatt
ggacaaacaacattttaa

DBGET integrated database retrieval system