KEGG   Thermoproteus uzoniensis: TUZN_0081Help
Entry
TUZN_0081         CDS       T01460                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TUZN_0081
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_0081
  Lipid metabolism
   00071 Fatty acid degradation
    TUZN_0081
  Amino acid metabolism
   00350 Tyrosine metabolism
    TUZN_0081
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TUZN_0081
   00626 Naphthalene degradation
    TUZN_0081
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TUZN_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
75393..76487
Genome map
AA seq 364 aa AA seqDB search
MTEENKPKGRAAVFRGYGQPFTIEEVEIPQPKGEQVVVRTAGCGLCHTDLHIWLGELPGV
PEKVPSVLGHEPSGYVAAKGDAVPDRVKIGMPVLVQGGYYLEDDIYTLKGLNQMAVKKSQ
SWTGAYGLYGGCYAEYFLVPSYRYLVSAEGLDDLAAAAVLTDAGLTPYRAVKTALKLVGE
FAEPGDVVVAVGVGGLGSFGVQWANVLAPHLDVVAVDAKEEALEFARKVGKIYALVDAKR
GDPAKAVAEAAAGRKIVAVLDFVGAEQTISKYIDLLSPEGVYVVVGLGGVRGSFPIADLV
INEKKIVGSLWGSVADLTEVVDYARRRAVNYGGLVTKRWKLDEINEAFQAMRRGQYVGRM
VVAP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggagaacaaacctaagggcagggccgccgtctttcggggctacggccagccg
ttcactatcgaggaggtcgagattcctcaaccaaaaggcgagcaggtcgtcgtgaggacc
gcggggtgtggactgtgccatacagatctgcacatatggctgggagagctacctggcgtt
cccgagaaggtgccgtcggtgctggggcacgagccctcgggctacgtcgcggcgaaaggc
gatgccgtgcccgaccgcgttaagatcggcatgccagtgttggtccaaggcgggtactac
ctagaggacgacatctacaccctcaaggggcttaaccagatggccgtcaagaagtcccag
agctggacaggcgcctacggtctctacggaggctgctatgccgaatacttcttggtgccc
agctacagatatcttgtgtcggccgaggggctggacgacttggcggccgccgctgttctg
accgacgcggggctaacgccgtatagggcagtgaagaccgcccttaagcttgtcggggag
tttgcggagccgggcgacgtcgtggtggccgtcggcgtcggcggcctcggatccttcggc
gtccagtgggccaacgtcctcgcgccccatctcgatgtggtggccgtagacgccaaggag
gaggcgctcgagttcgcaaggaaggtgggcaagatatatgcgttggtcgacgccaagagg
ggcgatccggccaaggcggtggccgaggcggccgcgggcagaaagatagtcgctgtgttg
gacttcgtaggggccgaacagactatatcgaaatacatagatttactgtcgccggagggc
gtctacgtggtcgtgggcctcggcggcgttagaggcagtttcccgatcgccgacttggta
atcaacgagaagaagatagtggggagtctctggggttcagtggctgacctcacggaagtg
gtagactatgcaaggaggcgcgcggttaactacggaggcttggtgacgaagaggtggaag
ctggacgaaatcaacgaggcgtttcaggccatgcgtaggggccagtacgtcgggaggatg
gtggtggctccctag

  All links  
No link information was found.   
DBGET integrated database retrieval system