KEGG   Thermoproteus uzoniensis: TUZN_0081Help
Entry
TUZN_0081         CDS       T01460                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
tuz  Thermoproteus uzoniensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
75393..76487
Genome map
AA seq 364 aa AA seqDB search
MTEENKPKGRAAVFRGYGQPFTIEEVEIPQPKGEQVVVRTAGCGLCHTDLHIWLGELPGV
PEKVPSVLGHEPSGYVAAKGDAVPDRVKIGMPVLVQGGYYLEDDIYTLKGLNQMAVKKSQ
SWTGAYGLYGGCYAEYFLVPSYRYLVSAEGLDDLAAAAVLTDAGLTPYRAVKTALKLVGE
FAEPGDVVVAVGVGGLGSFGVQWANVLAPHLDVVAVDAKEEALEFARKVGKIYALVDAKR
GDPAKAVAEAAAGRKIVAVLDFVGAEQTISKYIDLLSPEGVYVVVGLGGVRGSFPIADLV
INEKKIVGSLWGSVADLTEVVDYARRRAVNYGGLVTKRWKLDEINEAFQAMRRGQYVGRM
VVAP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggagaacaaacctaagggcagggccgccgtctttcggggctacggccagccg
ttcactatcgaggaggtcgagattcctcaaccaaaaggcgagcaggtcgtcgtgaggacc
gcggggtgtggactgtgccatacagatctgcacatatggctgggagagctacctggcgtt
cccgagaaggtgccgtcggtgctggggcacgagccctcgggctacgtcgcggcgaaaggc
gatgccgtgcccgaccgcgttaagatcggcatgccagtgttggtccaaggcgggtactac
ctagaggacgacatctacaccctcaaggggcttaaccagatggccgtcaagaagtcccag
agctggacaggcgcctacggtctctacggaggctgctatgccgaatacttcttggtgccc
agctacagatatcttgtgtcggccgaggggctggacgacttggcggccgccgctgttctg
accgacgcggggctaacgccgtatagggcagtgaagaccgcccttaagcttgtcggggag
tttgcggagccgggcgacgtcgtggtggccgtcggcgtcggcggcctcggatccttcggc
gtccagtgggccaacgtcctcgcgccccatctcgatgtggtggccgtagacgccaaggag
gaggcgctcgagttcgcaaggaaggtgggcaagatatatgcgttggtcgacgccaagagg
ggcgatccggccaaggcggtggccgaggcggccgcgggcagaaagatagtcgctgtgttg
gacttcgtaggggccgaacagactatatcgaaatacatagatttactgtcgccggagggc
gtctacgtggtcgtgggcctcggcggcgttagaggcagtttcccgatcgccgacttggta
atcaacgagaagaagatagtggggagtctctggggttcagtggctgacctcacggaagtg
gtagactatgcaaggaggcgcgcggttaactacggaggcttggtgacgaagaggtggaag
ctggacgaaatcaacgaggcgtttcaggccatgcgtaggggccagtacgtcgggaggatg
gtggtggctccctag

DBGET integrated database retrieval system