KEGG   Thermoproteus uzoniensis: TUZN_0171Help
Entry
TUZN_0171         CDS       T01460                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TUZN_0171
Enzymes [BR:tuz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     TUZN_0171
Peptidases [BR:tuz01002]
 Cysteine Peptidases
  Family C44
   TUZN_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
160823..161710
Genome map
AA seq 295 aa AA seqDB search
MSLPELLAAAASRARCDGVLLSGGLDSATVAWALTKAGLKPVGFNTQYAPAPGSDVPHLM
EVARALRLRVVVSWVGEEEAVKAAEEVVGILKVFNPMEVVNCAAAYVSMRAAAEMGVRRI
CTGDGGDELFAGYEYMQRMEPRELDEYIRRLAEGRWYFCAFDVGKALGVEVAAPYLDPEV
VRYALSVPAEEKVRGGVGKYVVRRQFQGLLPDSVVWRRKDPIEVGSGFSALYDVLARRAE
GYSADIPVQGAAKYLYKAFRERGLTYERDKESPCPVCGYKLRDGYCPMCGYYARA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccccgagcttctggccgctgccgcttcgcgggcgcgttgcgacggcgtcttg
ctgtccggcggcctcgactccgccacggtggcctgggccttgaccaaagccggcctcaag
ccggtagggttcaacacacagtacgccccggcgccgggttccgacgtgccgcacctcatg
gaggtggcgagagctctgcggctgagggtagtcgtcagctgggtgggcgaggaggaggcc
gtgaaggcggccgaggaggtggtgggcatcctcaaggtcttcaaccccatggaggtcgtc
aactgcgccgccgcgtacgtcagcatgagggccgccgccgagatgggcgtgagaaggata
tgcaccggcgacgggggcgacgagctctttgcggggtacgaatacatgcagaggatggag
ccgagggagctcgacgagtatatccgcaggctggccgagggcaggtggtacttctgcgcc
ttcgacgtggggaaggcgctcggcgtcgaggtcgccgccccctatctggaccccgaggtg
gttcggtacgccctgtccgtacccgccgaggagaaggtgaggggcggcgtggggaaatac
gtcgtgaggaggcagttccaaggccttctgcccgactcggtggtgtggaggcggaaggac
cccatagaggtcggcagcggcttctcggccctatacgacgtcctggcgcgtagggccgag
ggctactccgccgatatacccgtccagggcgcggcgaagtacctctacaaggcgtttagg
gagaggggcttgacctacgagagggataaggagtcgccgtgtcccgtgtgcgggtacaag
ctgagggacggctactgccccatgtgcgggtactacgctagggcttga

DBGET integrated database retrieval system