KEGG   Thermoproteus uzoniensis: TUZN_0208Help
Entry
TUZN_0208         CDS       T01460                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00620  Pyruvate metabolism
tuz00640  Propanoate metabolism
tuz00680  Methane metabolism
tuz00720  Carbon fixation pathways in prokaryotes
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
tuz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_0208
   00620 Pyruvate metabolism
    TUZN_0208
   00640 Propanoate metabolism
    TUZN_0208
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_0208
   00680 Methane metabolism
    TUZN_0208
Enzymes [BR:tuz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TUZN_0208
Lipid biosynthesis proteins [BR:tuz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TUZN_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEA11707
UniProt: F2L1W6
Position
191299..193179
Genome map
AA seq 626 aa AA seqDB search
MEVWRPERNHLENSNVAKYMSIHGFKTLEEFIAYTYEKPDEFWASFDREILRLRWYEEYG
KVLDLSRGVQWPRWFVGGRINIADQLDDSADPLVKWEGEDGTTAIWSYSEVLYKARAVAS
WLKRNGLEKGDRVAVFMPMVPEIVPVMLGAIRAGGIIVPLFSGFGKEAIRVRLEDSEAKF
VFASDVSYRRGKEIDMLSELKAGLTQSVRHVVVHERAGRPSGYVPLSDVFRTGGDYVERA
SSEDPVMIIYTSGTTGKPKGTVHTHDGFPIKAAADVYFHFDIGRGDTLSWVTDMGWMMGP
WMVFAAYLLRGSMAFFEGAPDYPKDRLWRFVERFRVKSLGLAATLTRYLRSIGASAEPGQ
LDRLEAFGNTGEPIDVESWLWLYKMGRGRIPIINYSGGTEISGGILGCYVVKPIKPSSFN
GASIGTKAAVFAEDGRPAPPGVEGELVVLSVWPGMTRGFWRDPQRYLDTYWSKWPGVWAH
GDAAMVDQDGYFYILGRADDTIKVAGKRLGPAEIETVLNAHPAVAESACIGVPHEVKGEV
PICFVVLKPGYEPSEALRRELIKLTEEALGKAFGAVEDIKFVKMLPKTRNAKIMRRVIRA
VYLGRNPGDLSALENPDAIEEIKRAV
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggaggtctggagacccgaaagaaaccacctagaaaattctaatgttgctaaatatatg
tctattcacggcttcaaaactctcgaagagttcattgcctatacctacgagaaacccgac
gagttttgggcttccttcgaccgcgaaatactgaggcttaggtggtacgaggagtacgga
aaggttctggatctctcgcggggggtccagtggccgcggtggtttgtaggggggcgtata
aacatagccgaccagctagacgactcggcggatcccttggtcaaatgggagggggaggac
ggcactacggcgatctggagctactcggaggtgctctacaaggccagggccgtggctagc
tggctcaaacgcaacggcttggagaagggggaccgcgtcgcggtctttatgcccatggtg
cccgagatagtgccggtcatgctgggcgccataagggctggcggcataatagtgcctctc
ttcagcggcttcggcaaggaggccatcagagttaggctagaggacagcgaggccaagttc
gtcttcgcctcggacgtgtcgtaccgcagaggtaaggagatagacatgctgtcggagctc
aaggccggcctaacgcaaagcgtgaggcacgtggtggtgcatgagagggccggaaggccg
agcggctacgtcccgctctcagacgtgttcaggacgggcggggactacgtcgagagggca
tcttcggaggaccccgtcatgatcatctacacctcgggcaccaccgggaagcccaagggc
accgtccacacacacgacggattccccataaaggcggccgccgacgtctatttccacttc
gacataggcagaggcgatacgttgagctgggtgaccgacatgggctggatgatggggcct
tggatggtcttcgcggcgtacctcctcaggggctctatggcgttcttcgagggggctccc
gactaccccaaggacaggctgtggcgctttgtggagaggtttagggtcaagtcgttaggc
ctcgccgcaactctcactaggtatctcagaagcataggcgcgtcggcggagcccgggcag
ttagaccgtcttgaggcgttcggcaacacaggcgagcccatagacgtcgagagctggctc
tggctgtacaagatgggcagggggaggatacctataataaactactcgggcggcacggag
atctcgggaggcatattgggctgctacgtggtcaagcccataaagccgagctccttcaac
ggcgccagcataggcaccaaggccgcggtcttcgccgaggacggcaggccggctcctccg
ggcgtggagggagagctggtcgtcctgtcggtgtggcccggcatgactaggggcttctgg
agggatccgcaacgctatctggatacgtactggagcaagtggcccggcgtgtgggcccac
ggcgacgccgccatggtcgaccaagacggctacttctacatcttggggagggccgacgac
actataaaggtggctgggaagcgtctgggccccgccgagattgagaccgtcctcaacgcc
caccccgccgtggctgagtccgcctgtataggcgtcccccacgaggtcaagggcgaggtc
cccatatgtttcgtggtgctgaagccgggctacgagcccagcgaggccttgaggcgcgag
ctcataaagctcaccgaggaggctttggggaaggccttcggcgcggtggaggatataaag
tttgtcaagatgttgccgaagacgcgcaacgccaagatcatgaggagggtcataagggcc
gtctacctaggccgcaaccccggcgatctgtcggccttggagaaccccgacgccatcgag
gagatcaagagggcggtataa

DBGET integrated database retrieval system