KEGG   Thermoproteus uzoniensis: TUZN_0208Help
Entry
TUZN_0208         CDS       T01460                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_0208
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_0208
   00620 Pyruvate metabolism
    TUZN_0208
   00640 Propanoate metabolism
    TUZN_0208
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_0208
   00680 Methane metabolism
    TUZN_0208
Enzymes [BR:tuz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TUZN_0208
Lipid biosynthesis proteins [BR:tuz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TUZN_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191299..193179
Genome map
AA seq 626 aa AA seqDB search
MEVWRPERNHLENSNVAKYMSIHGFKTLEEFIAYTYEKPDEFWASFDREILRLRWYEEYG
KVLDLSRGVQWPRWFVGGRINIADQLDDSADPLVKWEGEDGTTAIWSYSEVLYKARAVAS
WLKRNGLEKGDRVAVFMPMVPEIVPVMLGAIRAGGIIVPLFSGFGKEAIRVRLEDSEAKF
VFASDVSYRRGKEIDMLSELKAGLTQSVRHVVVHERAGRPSGYVPLSDVFRTGGDYVERA
SSEDPVMIIYTSGTTGKPKGTVHTHDGFPIKAAADVYFHFDIGRGDTLSWVTDMGWMMGP
WMVFAAYLLRGSMAFFEGAPDYPKDRLWRFVERFRVKSLGLAATLTRYLRSIGASAEPGQ
LDRLEAFGNTGEPIDVESWLWLYKMGRGRIPIINYSGGTEISGGILGCYVVKPIKPSSFN
GASIGTKAAVFAEDGRPAPPGVEGELVVLSVWPGMTRGFWRDPQRYLDTYWSKWPGVWAH
GDAAMVDQDGYFYILGRADDTIKVAGKRLGPAEIETVLNAHPAVAESACIGVPHEVKGEV
PICFVVLKPGYEPSEALRRELIKLTEEALGKAFGAVEDIKFVKMLPKTRNAKIMRRVIRA
VYLGRNPGDLSALENPDAIEEIKRAV
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggaggtctggagacccgaaagaaaccacctagaaaattctaatgttgctaaatatatg
tctattcacggcttcaaaactctcgaagagttcattgcctatacctacgagaaacccgac
gagttttgggcttccttcgaccgcgaaatactgaggcttaggtggtacgaggagtacgga
aaggttctggatctctcgcggggggtccagtggccgcggtggtttgtaggggggcgtata
aacatagccgaccagctagacgactcggcggatcccttggtcaaatgggagggggaggac
ggcactacggcgatctggagctactcggaggtgctctacaaggccagggccgtggctagc
tggctcaaacgcaacggcttggagaagggggaccgcgtcgcggtctttatgcccatggtg
cccgagatagtgccggtcatgctgggcgccataagggctggcggcataatagtgcctctc
ttcagcggcttcggcaaggaggccatcagagttaggctagaggacagcgaggccaagttc
gtcttcgcctcggacgtgtcgtaccgcagaggtaaggagatagacatgctgtcggagctc
aaggccggcctaacgcaaagcgtgaggcacgtggtggtgcatgagagggccggaaggccg
agcggctacgtcccgctctcagacgtgttcaggacgggcggggactacgtcgagagggca
tcttcggaggaccccgtcatgatcatctacacctcgggcaccaccgggaagcccaagggc
accgtccacacacacgacggattccccataaaggcggccgccgacgtctatttccacttc
gacataggcagaggcgatacgttgagctgggtgaccgacatgggctggatgatggggcct
tggatggtcttcgcggcgtacctcctcaggggctctatggcgttcttcgagggggctccc
gactaccccaaggacaggctgtggcgctttgtggagaggtttagggtcaagtcgttaggc
ctcgccgcaactctcactaggtatctcagaagcataggcgcgtcggcggagcccgggcag
ttagaccgtcttgaggcgttcggcaacacaggcgagcccatagacgtcgagagctggctc
tggctgtacaagatgggcagggggaggatacctataataaactactcgggcggcacggag
atctcgggaggcatattgggctgctacgtggtcaagcccataaagccgagctccttcaac
ggcgccagcataggcaccaaggccgcggtcttcgccgaggacggcaggccggctcctccg
ggcgtggagggagagctggtcgtcctgtcggtgtggcccggcatgactaggggcttctgg
agggatccgcaacgctatctggatacgtactggagcaagtggcccggcgtgtgggcccac
ggcgacgccgccatggtcgaccaagacggctacttctacatcttggggagggccgacgac
actataaaggtggctgggaagcgtctgggccccgccgagattgagaccgtcctcaacgcc
caccccgccgtggctgagtccgcctgtataggcgtcccccacgaggtcaagggcgaggtc
cccatatgtttcgtggtgctgaagccgggctacgagcccagcgaggccttgaggcgcgag
ctcataaagctcaccgaggaggctttggggaaggccttcggcgcggtggaggatataaag
tttgtcaagatgttgccgaagacgcgcaacgccaagatcatgaggagggtcataagggcc
gtctacctaggccgcaaccccggcgatctgtcggccttggagaaccccgacgccatcgag
gagatcaagagggcggtataa

DBGET integrated database retrieval system