KEGG   Thermoproteus uzoniensis: TUZN_0293Help
Entry
TUZN_0293         CDS       T01460                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tuz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(261941..262831)
Genome map
AA seq 296 aa AA seqDB search
MPLALLGKLPVGSGHPVRIMGVVNASPESFYASSIAATPEKAVELAASWRGFVDVIDVGG
MSTAPYKDTWVPAEEELKRVVPVVKALSQHVDVPISVDTYRPRVAEEALKAGASIVNDVT
GLKLYPEMCGVVKDYGASLVLMAREREPRPGADPVDRLISALRESLDAALKCGVDPEKIV
VDPGIGFPILPPGDLPYVVAGEYRHGDPQWPWWRWDLYVLKNLGRFKELGRPVLVGVSRK
SFIRRLVGARTPDEVLPGSVAAEALAVLHGADIVRTHNPRETWQAVRLAEALRNLK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcgccctcttgggcaagctgcccgtgggctccggccatccggtaaggattatg
ggagttgtaaacgcctcgcccgagtccttctacgcgagctcgatcgccgccacgcccgag
aaggccgtggagttggccgccagctggaggggcttcgtggacgtgatagacgtgggaggc
atgtccaccgcgccttataaggatacgtgggtgcctgcagaggaggagctgaagcgcgtc
gtgccggtcgtcaaggccctttcccaacacgttgatgtgcccatcagcgtagacacctat
aggcccagagtggctgaggaggcgctcaaggcaggggcctctatagtgaacgacgtgacg
ggcctcaagctctaccccgagatgtgtggggtggtcaaagactacggggcgtcgttggtc
ttgatggcccgggagagggagccgaggcccggggctgaccccgtggataggctcatctcg
gcattgcgggagagcctcgacgccgcccttaaatgcggggtggatccggaaaagatcgtc
gtggatcccggcatagggttcccgatcctgcctccgggagatctgccgtacgtagttgcc
ggcgagtatagacacggcgatccccagtggccttggtggaggtgggacctctacgtctta
aaaaacctcgggagattcaaggagctgggcaggcccgtgttggtgggggtatccaggaag
tccttcataaggaggctcgtcggcgcgcggactcccgacgaggtcctgcccggctcagta
gccgccgaggcgctggcagtgctacacggcgccgacatcgtgaggacccacaaccctagg
gagacctggcaagccgtcagactggcggaggcgttgagaaaccttaaataa

DBGET integrated database retrieval system