KEGG   Thermoproteus uzoniensis: TUZN_0346Help
Entry
TUZN_0346         CDS       T01460                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TUZN_0346
Enzymes [BR:tuz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TUZN_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(307415..308860)
Genome map
AA seq 481 aa AA seqDB search
MLRGAGILLPLFSLPGPHGIGDMGPAAYRFVEFLRDAGQTYWQLLPLNPVLPEYDNSPYS
STSSFAGEPAYISLELLAEQGVLRRSASAEFGAGRADYEAARAYKVKIIAEAERPKDLDE
FVGRNEWLEDYALYSALREYFGRPWVEWPRELRDRDPAALRQWREKLRRRIELEYLLQYF
FWTQWRELKRHANSLGIFLIGDLPIYLSLDSADVWAHRELFKLDAEGRPLYVAGVPPDYF
SPTGQLWGNPVYDWDAMRKEGFRWWLDRLRYTLSVFDYVRLDHFRGYAAYWEVPAGEKTA
VNGRWVPAPGGELLERARDELGGLKIIAEDLGYITPDVVELRDRFGLPGMRVLQFAWDGN
PANEHKPHNHVKNSVVYTGTHDNNTIVGWFFREASPKARREALEYMGRRSAKDIHWAFIR
LAYFSVADVAVVPMQDFMGLGPEARINRPGTRGGNWVWRMTELPGRALARRIRRLARLYG
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggggggcggggatccttctgcctctgttctccctcccgggcccccacgggatc
ggcgacatggggcccgccgcgtaccgattcgtggagttcttgagggatgccggccagacg
tattggcagctgttgcccctaaaccccgtgttgccggagtacgacaactcgccctacagc
tccacctcgtccttcgccggggagccggcgtacataagcctggagctcctggcggagcaa
ggcgtgttgaggagatccgcctcggcggaattcggggcgggccgcgccgattacgaagcc
gcgcgggcctacaaggtcaagataatcgccgaggcggagaggccgaaggacctcgacgag
ttcgtggggaggaacgagtggcttgaggactacgccctctactcggcgttgagggagtac
ttcggacggccttgggtggagtggccgagggagctgagggatagagatccggcggccttg
aggcagtggcgcgagaagttgcggaggaggatagagcttgagtacctcctccagtacttc
ttctggacgcagtggcgcgagctgaagcggcacgccaactcgctgggcatcttcctcata
ggcgacctcccgatatacctgagcctcgacagcgccgacgtgtgggcccacagagagctg
ttcaagctcgacgcggagggccggcccctatacgtggcgggggtgccgcccgactacttc
tcgcccaccggccagctgtggggcaaccccgtctacgattgggacgccatgaggaaggag
gggtttaggtggtggctcgacagactgaggtacacgctctcggtcttcgactacgtcagg
ctcgaccacttccgcggctatgccgcctactgggaggtgccggccggcgagaagactgct
gtgaacggccgctgggtccccgctccgggcggggagctcctggaaagggcgagggatgag
ctgggcgggctcaagataatcgcggaggatctcggctacataacgcccgacgtggtggag
ctgagagaccgcttcgggttgccgggcatgagggtgctgcagttcgcctgggatggcaac
ccggcgaacgagcacaagccccataaccacgtcaagaactcggtcgtctacacgggcacc
cacgacaacaacacgatagtgggctggttcttccgcgaggcgtcccccaaggcgaggagg
gaggcgttggagtacatgggcagacgctccgccaaggatatacactgggccttcataagg
ctggcgtacttctcggtggccgacgtggccgtcgtgcctatgcaggacttcatggggctt
gggccagaagcgcgtataaataggccgggaactagaggcggaaactgggtctggaggatg
acagagctccccgggcgggcgttggccaggcggataaggcggctggcccggctctacggc
cgttga

DBGET integrated database retrieval system