KEGG   Thermoproteus uzoniensis: TUZN_0389Help
Entry
TUZN_0389         CDS       T01460                                 

Definition
pyrophosphate-dependent phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_0389
   01230 Biosynthesis of amino acids
    TUZN_0389
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_0389
   00030 Pentose phosphate pathway
    TUZN_0389
   00051 Fructose and mannose metabolism
    TUZN_0389
   00052 Galactose metabolism
    TUZN_0389
  Energy metabolism
   00680 Methane metabolism
    TUZN_0389
Enzymes [BR:tuz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TUZN_0389
Protein phosphatases and associated proteins [BR:tuz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TUZN_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(342029..343039)
Genome map
AA seq 336 aa AA seqDB search
MKIGVLTGGGDAPGLNIAVYTFVKLAERKHEVYAIFHGWKGLLNKEVKRVTSVDLLDFAF
TGGTYIKTSRTNPFKDEERAKTLAKNVEELSLDVVVAIGGDDTLGAAGEAQRRGILDAVG
IPKTIDNDVWGTDYTIGFDTAVNEAVKAAESFKTTLISHERVGVVEVMGREAGWIALHTG
LATMADFVLIPEREVSWDFVAERVKKAYEAKRWALVVVSEGIKSYGGPVDEFGHVRLGGV
GNELAAFLEKKTGLETRATIPGHIIRGAPPSAFDRVLAVRYATAAYEAVEEGKFGVMTAY
RDGEISYIPITEVVGRNKLVSGPWLKLYETYWGNSE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcgtattgaccggcggaggcgacgcgccgggcctcaacatagccgtatat
acctttgtcaagctcgccgagaggaagcacgaggtctacgccatcttccacggctggaag
ggcctcctcaacaaggaggtcaagagggtgacgtccgtagatctgctggacttcgccttt
acgggaggcacatacataaagacctcgaggacgaacccgtttaaggacgaggagagggcg
aagacgttggccaagaacgtcgaggagctgagcctagacgtcgttgtggctatagggggc
gatgacacgttgggggccgccggcgaggcgcagaggcgcggaatactggatgcggtcggg
ataccgaagactatagacaacgacgtctggggcaccgactacaccatagggttcgacacg
gccgtcaacgaggccgtcaaggccgccgagagcttcaagaccacgttgatatcccacgag
agggtcggcgtagtggaggtgatgggcagggaggccgggtggatagcgctacacacaggt
cttgcgaccatggccgacttcgtgttgatacccgagagagaggtaagctgggacttcgtg
gccgagcgcgtgaagaaggcctacgaggccaagaggtgggcgctggtcgtcgtgtcggag
ggcattaagtcctacggagggcctgtggacgagttcggccacgtaaggctcggcggagtc
ggcaacgagctcgccgcctttctcgagaagaagacaggcctcgagactagggccacgata
cccggccacataattagaggagccccgccgtccgctttcgacagagtgctggcggtcaga
tacgccacagcggcctacgaggccgtggaggagggcaaattcggcgtcatgaccgcgtat
agggacggcgagatatcgtacatccccataacggaagtcgtgggcaggaacaagctggtg
agcgggccctggctcaagctctacgagacgtattggggtaactcggaatag

DBGET integrated database retrieval system