KEGG   Thermoproteus uzoniensis: TUZN_0389Help
Entry
TUZN_0389         CDS       T01460                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00030  Pentose phosphate pathway
tuz00051  Fructose and mannose metabolism
tuz00052  Galactose metabolism
tuz00680  Methane metabolism
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_0389
   00030 Pentose phosphate pathway
    TUZN_0389
   00051 Fructose and mannose metabolism
    TUZN_0389
   00052 Galactose metabolism
    TUZN_0389
  Energy metabolism
   00680 Methane metabolism
    TUZN_0389
Enzymes [BR:tuz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TUZN_0389
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TUZN_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat Bmp
Motif
Other DBs
NCBI-ProteinID: AEA11885
UniProt: F2L2U7
Position
complement(342029..343039)
Genome map
AA seq 336 aa AA seqDB search
MKIGVLTGGGDAPGLNIAVYTFVKLAERKHEVYAIFHGWKGLLNKEVKRVTSVDLLDFAF
TGGTYIKTSRTNPFKDEERAKTLAKNVEELSLDVVVAIGGDDTLGAAGEAQRRGILDAVG
IPKTIDNDVWGTDYTIGFDTAVNEAVKAAESFKTTLISHERVGVVEVMGREAGWIALHTG
LATMADFVLIPEREVSWDFVAERVKKAYEAKRWALVVVSEGIKSYGGPVDEFGHVRLGGV
GNELAAFLEKKTGLETRATIPGHIIRGAPPSAFDRVLAVRYATAAYEAVEEGKFGVMTAY
RDGEISYIPITEVVGRNKLVSGPWLKLYETYWGNSE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcgtattgaccggcggaggcgacgcgccgggcctcaacatagccgtatat
acctttgtcaagctcgccgagaggaagcacgaggtctacgccatcttccacggctggaag
ggcctcctcaacaaggaggtcaagagggtgacgtccgtagatctgctggacttcgccttt
acgggaggcacatacataaagacctcgaggacgaacccgtttaaggacgaggagagggcg
aagacgttggccaagaacgtcgaggagctgagcctagacgtcgttgtggctatagggggc
gatgacacgttgggggccgccggcgaggcgcagaggcgcggaatactggatgcggtcggg
ataccgaagactatagacaacgacgtctggggcaccgactacaccatagggttcgacacg
gccgtcaacgaggccgtcaaggccgccgagagcttcaagaccacgttgatatcccacgag
agggtcggcgtagtggaggtgatgggcagggaggccgggtggatagcgctacacacaggt
cttgcgaccatggccgacttcgtgttgatacccgagagagaggtaagctgggacttcgtg
gccgagcgcgtgaagaaggcctacgaggccaagaggtgggcgctggtcgtcgtgtcggag
ggcattaagtcctacggagggcctgtggacgagttcggccacgtaaggctcggcggagtc
ggcaacgagctcgccgcctttctcgagaagaagacaggcctcgagactagggccacgata
cccggccacataattagaggagccccgccgtccgctttcgacagagtgctggcggtcaga
tacgccacagcggcctacgaggccgtggaggagggcaaattcggcgtcatgaccgcgtat
agggacggcgagatatcgtacatccccataacggaagtcgtgggcaggaacaagctggtg
agcgggccctggctcaagctctacgagacgtattggggtaactcggaatag

DBGET integrated database retrieval system